2D4E


Conserved Protein Domain Family
HpaE

?
TIGR02299: HpaE 
Click on image for an interactive view with Cn3D
5-carboxymethyl-2-hydroxymuconate semialdehyde dehydrogenase
This model represents the dehydrogenase responsible for the conversion of 5-carboxymethyl-2-hydroxymuconate semialdehyde to 5-carboxymethyl-2-hydroxymuconate (a tricarboxylic acid). This is the step in the degradation of 4-hydroxyphenylacetic acid via homoprotocatechuate following the oxidative opening of the aromatic ring.
Statistics
?
PSSM-Id: 131352
View PSSM: TIGR02299
Aligned: 6 rows
Threshold Bit Score: 828.293
Threshold Setting Gi: 33567323
Created: 8-Oct-2014
Updated: 23-Jan-2015
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2D4E_A       27 ALHFIAGEFVPSESgeTFPSLDPATNEVLGVAARGGEREVDRAAKAAHEAFQ-RWSRTKAKERKRYLLRIAELIEKHADE 105
gi 33567323   3 IEHLIDGKAVAGKQ--YFETINPATQETLAEVAAGGEAEVHAAVAAAKAAFP-KWAGLPAAERARLVRKLGDLIAAHVPE 79
gi 22778556  24 IKLYINGEFMDAEDrgTFDNISPFSNEKINSVASGQAADIDKAVQSAKKAFKgEWGNLKQVERLEYVYKIGDLIEQHTDE 103
gi 27351225  30 IGHMIDGKIVPSISgeTFETKSPVDGAVLASVARGNAEDIDRAATAAALAFK-SWREMGPAMRKKLLHRVADAIEDNADD 108
gi 37198514  24 LGHFINGEWTLGSKgeTFDNLTPTDNTSLGKVVKGTAEDVDAACEAAQQAFT-AWAEMSGAERKKILHKLADKIEQRAEE 102
gi 46196525  27 ALHFIAGEFVPSESgeTFPSLDPATNEVLGVAARGGEREVDRAAKAAHEAFQ-RWSRTKAKERKRYLLRIAELIEKHADE 105
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2D4E_A      106 LAVMECLDAGQVLRIVR-AQVARAAENFAFYAEYAEhAMEDRTFPVDrDWLYYTVRVPAGPVGIITPWNAPLMLSTWRIA 184
gi 33567323  80 ISRTETNDCGQTIAQTGkQLVPRAADNFYYFAEMCT-RVDGHTYPTP-THLNYTLYHPVGVCALISPWNVPFMTATWKVA 157
gi 22778556 104 IAILESLDTGLPISQTR-KQVSRSANNFRFYADTVKsQMYGEVYQVDdEFINYTVRSAVGVAGLITPWNAPFMLETWKIA 182
gi 27351225 109 IAVLECIDTGQAYRFMA-KAAIRAAENFRFFADKCAeARDGQNTPSD-EHWNVSTRVPIGPVGVITPWNTPFMLSTWKIA 186
gi 37198514 103 IALVESMDCGQPLRFMR-QAAIRGAANFRFFADKSPeAKNGLSLHQD-THTNYTIRTPIGPVGVITPWNTPFMLSTWKIA 180
gi 46196525 106 LAVMECLDAGQVLRIVR-AQVARAAENFAFYAEYAEhAMEDRTFPVDrDWLYYTVRVPAGPVGIITPWNAPLMLSTWRIA 184
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2D4E_A      185 PALAFGNTVVLKPAEWSPFTATKLAEILKEADLPPGVFNLVQGFGEEAGAALVAHPLVPLLTLTGETETGKIVMRNaaDH 264
gi 33567323 158 PCLAFGNTAVLKMSELSPLTAARLGELALEAGIPPGVLNLVHGYGRDAGEPLVAHPDVRAVSFTGSTATGNRIVQA--AG 235
gi 22778556 183 PALATGNTVILKPAEWSPLTANRMAEIIDQAGLPDGVFNIVHGFGETAGDALVKHPDVQLISFTGETTTGSTIMRNgaDA 262
gi 27351225 187 PALAAGCTVVHKPAEWSPATAAILARLVKEAGVPDGVLNTVHGFGEEAGKALTEHPAIKAIGFVGESATGSAIMVQgaPT 266
gi 37198514 181 PALAAGCTVVHKPAEFSPLTAAILAECAKEAGLPDGVWNMVNGFGEVAGKTLTEHKAIKAVAFVGETVTGSMIQAQgaPT 260
gi 46196525 185 PALAFGNTVVLKPAEWSPFTATKLAEILKEADLPPGVFNLVQGFGEEAGAALVAHPLVPLLTLTGETETGKIVMRNaaDH 264
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2D4E_A      265 LKRLSPELGGKSPALVFADADLERALDAVVFQIFSFNGERCTASSRLLVEEKIFEDFVGKVVERARAIRVGHPLDPETEV 344
gi 33567323 236 LKKFSMELGGKSPFVIFDDADLDRALDAAIFMIFSNNGQRCTAGSRILVQQSIYADFTQKFVERARRIRVGDPLDEGTIV 315
gi 22778556 263 LKRFSMELGGKSPIIVFEDADLERALDAATWGIFSFNGERCTANSRLYLHESIADEFIEKLKQRVWNIRVGDPLENNTQI 342
gi 27351225 267 LKRVHFELGGKNPVIVFDDADLDRALDAVVFMIYSLNGERCTSSSRLLIQQSIAEKFVEKLTARVKALKVGHPLDPSTEI 346
gi 37198514 261 LKRVHFELGGKNPVIVFDDADFERALDAVVFMIYSLNGQRCTSSSRLLIQNGIKPKFIEALKQRVESLQVGHPLDPETEV 340
gi 46196525 265 LKRLSPELGGKSPALVFADADLERALDAVVFQIFSFNGERCTASSRLLVEEKIFEDFVGKVVERARAIRVGHPLDPETEV 344
                       330       340       350       360       370       380       390       400
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2D4E_A      345 GPLIHPEHLQRVLGYVEAGKREGARLLVGGERAKTs--FRGEDLSRGNYLLPTVFVGEn-HMKIAQEEIFGPVLVAIPFK 421
gi 33567323 316 GPLISPAHLAKVRGYIELGSKEGATMLCGGLDRPSyapELDARVRDGNFVWPTVFADVdnRMKIAQDEIFGPVACLIPFR 395
gi 22778556 343 GPLIKTEHYNNVKKYLKIAEEEGCEIISG---------VIPKELNRGNYVAPTILLNAsnEMRVVQEEIFGPVIAVMTFN 413
gi 27351225 347 GPLIHERHLAKVCSYFDVARKDGATIAVGGKAYDG--------PGGGHYVEPTLVTGAhgKMRVAQEEVFGPFLTVLPFK 418
gi 37198514 341 GPLVHQSHYNKVMSYMTAAEEDGATIAVGGRKLPE--------KGAGNYLTPTLFTDAdnTMRIAREEIFGPVLTCIGFD 412
gi 46196525 345 GPLIHPEHLQRVLGYVEAGKREGARLLVGGERAKTs--FRGEDLSRGNYLLPTVFVGEn-HMKIAQEEIFGPVLVAIPFK 421
                       410       420       430       440       450       460       470       480
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2D4E_A      422 DEEEALRKANDTKYGLAAYVFTRDLERAHRLALELEAGMVYLNSHNVRHLPTPFGGVKGSGDRREGGTYALDFYTDLKTI 501
gi 33567323 396 DEAHAIELANDIEYGLSSYVWTESVGRAHRVAAAIEAGMCFVNSQNVRDLRQPFGGTKASGTGREGGTWSYEVFCEPKNV 475
gi 22778556 414 DETEVIEKANDVRYGLAGYVWTNDMKRGHRVAHAIDSGMLWVNSQNVRDLRTPFGGSKDSGIGREGGHYAFEFYTEQKII 493
gi 27351225 419 DEADAIEVANDIRYGLTGYVWTNDVGRALRVADALEAGMIWLNSENVRHLPTPFGGMKASGIGRDGGDYSFDFYMETKHV 498
gi 37198514 413 SEEEALEIANDTDYGLSGYIWTSNTGRAMRMATKVEAGMIWVNSENNRNLPSPFGGVKMSGIGRDGGDWSFDFYMETKNV 492
gi 46196525 422 DEEEALRKANDTKYGLAAYVFTRDLERAHRLALELEAGMVYLNSHNVRHLPTPFGGVKGSGDRREGGTYALDFYTDLKTI 501
                       490
                ....*....|....
2D4E_A      502 ALPLRPPHVPKFGK 515
gi 33567323 476 AVSLGNHHIPHWGA 489
gi 22778556 494 HVAIGDHHIPQFGK 507
gi 27351225 499 SLARGTHKIQKLGI 512
gi 37198514 493 CIAHDLHRVPTLGK 506
gi 46196525 502 ALPLRPPHVPKFGK 515
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap