Conserved Protein Domain Family
TIGR02301

?
TIGR02301: TIGR02301 
TIGR02301 family protein
Members of this uncharacterized protein family are found in a number of alphaProteobacteria, including root nodule bacteria, Brucella suis, Caulobacter crescentus, and Rhodopseudomonas palustris. Conserved residues include two well-separated cysteines, suggesting a disulfide bond. The function is unknown.
Statistics
?
PSSM-Id: 131354
View PSSM: TIGR02301
Aligned: 6 rows
Threshold Bit Score: 158.792
Threshold Setting Gi: 159184595
Created: 8-Oct-2014
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23347470    6 RLFRLAAGAAALWLAVCPPVLAQDAPYEGKMLRLAEVLGSLHYLRNLCGEKG-SEWRDRMDAIIAAEKPPE-AERLKLVS 83
gi 14027227    4 APFLVALCLAASTAVAVRPAFSAESPFEPGLMRLAEVLGSLHFLRNLCGEKG-DQWRGEMEKLLDSENPDP-ERRARFIA 81
gi 15074039   24 AAQEKQPAPQTTAPSPSPAQEEKPTPYDQRLIRLAEILGSVHYLRNLCLDQSeDGWRRSTQELIDKEAAGEpKRRERITA 103
gi 27350817    3 TRFLAIFALILACASVPTRAQDVAAPFDADLQRLAEILGGLHYLRGICGSNEgNKWRSEMQALIDAETPSG-ERRTRMIA 81
gi 13425082    3 RPFLIGVCLASLIAAPVLAQERAPE-DRQRLLDIAYALGESHALRQTCQGEGdQYWRSRMVRLTEVEQADQ-AFDAQMRE 80
gi 499273971  22 GVAYAQPSKSVSEARPAEAAPPKPAPYDDKLARLSEILGAVQYLRTLCPSSGpEDWRKSMSALLAADTASEpERRQRMTA 101
                         90       100       110       120
                 ....*....|....*....|....*....|....*....|..
gi 23347470   84 SFNHGYRVFSDNYARCTPSALAAIDRYMKEGGDLSNEIISRY 125
gi 14027227   82 SFNRGYRSFGGTYTQCTASATEAISRYMKEGETLSRDIASRY 123
gi 15074039  104 AFNRGYRTFASVYTRCTEPATLAEERYRAEGATLASEIVARF 145
gi 27350817   82 GFNRGYNGFQQTYRSCTPAATVAIRRYIEEGSKISRDLTARY 123
gi 13425082   81 RFNTGFASRRSEYPICDDASRKAEQAVARKGQALALKLSQTM 122
gi 499273971 102 AFNRGYRSFAAIHTSCTRAAIMAEENYRNEGATLAQEIASRF 143
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap