1WZO


Conserved Protein Domain Family
HpaG-C-term

?
TIGR02303: HpaG-C-term 
Click on image for an interactive view with Cn3D
4-hydroxyphenylacetate degradation bifunctional isomerase/decarboxylase, C-terminal subunit
This model represents one of two subunits/domains of the bifunctional isomerase/decarboxylase involved in 4-hydroxyphenylacetate degradation. In E. coli and some other species this enzyme is encoded by a single polypeptide containing both this domain and the closely related N-terminal domain (TIGR02305). In other species such as Pasteurella multocida these domains are found as two separate proteins (usually as tandem genes). Together, these domains carry out the decarboxylation of 5-oxopent-3-ene-1,2,5-tricarboxylic acid (OPET) to 2-hydroxy-2,4-diene-1,7-dioate (HHDD) and the subsequent isomerization to 2-oxohept-3-ene-1,7-dioate (OHED).
Statistics
?
PSSM-Id: 131356
View PSSM: TIGR02303
Aligned: 5 rows
Threshold Bit Score: 429.232
Threshold Setting Gi: 46196524
Created: 8-Oct-2014
Updated: 23-Jan-2015
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1WZO_A        2 KLARFLAKGRVHQGVYR-EGLLLDEAGEAHRPEDVTWLLPFTP-GKILGVALNYADHAEELG--LSRPeEPALFWKPNTS 77
gi 22778552   2 RHARIAYNGLIQHAVET-NEGIKLEDGRIVNESQVTWLPPVEP-KTVFTLGLNYADHAAELSfkEAPK-EPLVFLKGPNT 78
gi 12721917   3 KYAKVMYQNQIHSVEVR-PNGLLTDQQQLLPSEAVTWLPPAS--GMMYALGLNYADHASELD--FKPPeKPLVFVKTHHT 77
gi 46196524   2 KLARFLAKGRVHQGVYR-EGLLLDEAGEAHRPEDVTWLLPFTP-GKILGVALNYADHAEELG--LSRPeEPALFWKPNTS 77
gi 37198513   2 KRARIEYLGDVLSVTIGdGDNAITADGRSLPAGQFTWLSPIENpGTIFALGLNYADHASELA--FEPPkEPLVFLKGANT 79
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1WZO_A       78 LLPHKGVVLYPKGARFVHYEVELAVVVGRPMKRVRAKDALDYVLGYTIANDLVARDYVTNTFRPPIRAKGRDTFLPLGPF 157
gi 22778552  79 FIGHLGETYRPSDVTFMHYECELAVVIGKTAKNVKKEEAYNYVRGYTVANDYALRDYLENYYRPNLRVKNRDTCTPIGPW 158
gi 12721917  78 YTGHNSTTWRPDNVDYMHYECELVVVIGKTAKNVKRDEAMDYVAGYTLCNDYAIRDYLENYYRPNLRVKNRVGTTPVGPW 157
gi 46196524  78 LLPHKGVVLYPKGARFVHYEVELAVVVGRPMKKVKAKDALDYVLGYTIANDLVARDYVTNTFRPPIRAKGRDTFLPLGPF 157
gi 37198513  80 LTAHQQPSYRPNDIEFMHYECELVAVVGKEARNVKREDAMDYIQGFTICNDYAIRDYLENYYRPNLRVKSRDSLCPIGPW 159
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1WZO_A      158 LV-VEEVEDPQDLWLRAYVNGELRQEGHTSRMLYSVAELLEFISEFMTLEPYDVLLTGTPKGISQVRPGDVMRLEIEGLG 236
gi 22778552 159 VVdKEDIEDPMNLQLTTYVNGEITQQGSTADMIFSVPHLIEYLSGLMTLNPGDIILTGTPKGSVDTKVGDEVITEVEGVG 238
gi 12721917 158 IVdKADVKDPMNLTLRTWVNGELCQEGNTKDMIFDIAYLIEHLSHITTLQPGDMIATGTPKGLADVKPGDCVEIEIEQIG 237
gi 46196524 158 LV-VEEVEDPQDLWLRAYVNGELRQEGHTSRMLYSVAELLEFISEFMTLEPYDVLLTGTPKGISQVRPGDVMRLEIEGLG 236
gi 37198513 160 IVdCDDIEDVNNLALTTHVNGELTQQGNTSDMIFDVPFLIEYLSSFMTLKPGDLIATGTPKGLKDIQPGDVVRCTIEGVG 239

                ....*....
1WZO_A      237 ALENPIEEE 245
gi 22778552 239 RLVNTIVGE 247
gi 12721917 238 KLTNYIVSE 246
gi 46196524 237 ALENPIEEE 245
gi 37198513 240 SLENPVLSE 248
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap