2YYG


Conserved Protein Domain Family
HpaB-1

?
TIGR02309: HpaB-1 
Click on image for an interactive view with Cn3D
4-hydroxyphenylacetate 3-monooxygenase, oxygenase component
This gene for this monooxygenase is found within apparent operons for the degradation of 4-hydroxyphenylacetic acid in Deinococcus, Thermus and Oceanobacillus. Phylogenetic trees support inclusion of the Bacillus halodurans sequence above trusted although the complete 4-hydroxyphenylacetic acid degradation pathway may not exist in that organism. Generally, this enzyme acts with the assistance of a small flavin reductase domain protein (HpaC) to provide the cycle the flavin reductant for the reaction. This family of sequences is a member of a larger subfamily of monooxygenases (pfam03241).
Statistics
?
PSSM-Id: 131362
View PSSM: TIGR02309
Aligned: 4 rows
Threshold Bit Score: 878.077
Threshold Setting Gi: 46196526
Created: 8-Oct-2014
Updated: 23-Jan-2015
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2YYG_A         2 ARTGAEYIEALKTRPPNLWYKGEKVEDPTTHPVFRGIVRTMAALYDLQHDPRYREVLTYEEEGKRHGMSFLIPKTKEDLK 81
gi 22778559    3 AKTGQQYIDKLKKANNNVYIHGERVEDVTTHPAFKGAVQSMAKLYDLQYEKPEKMLYTSPTTGDKVSKTFMAPETIEELI 82
gi 499191942  20 AVTGQRFLDRLRQNPPTLYIDGQRVADPTTHPSTRNMCQSLAGLYDLQFQEDLKETLTYEDGGKRYARSFMVPRTKDDLR 99
gi 46196526    2 ARTGAEYIEALKTRPPNLWYKGEKVEDPTTHPVFRGIVRTMAALYDLQHDPRYREVLTYEEEGKRHGMSFLIPKTKEDLK 81
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2YYG_A        82 RRGQAYKLWADQNLGMMGRSPDYLNAVVMAYAASADYFG------------EFAENVRNYYRYLRDQDLATTHALTNPQV 149
gi 22778559   83 ERREAIMEWQGITKGLMGRSPDYLNSEVMTMEKAYDYYGks--------nsLFAENAKKYAEYARENDISLTHTLIHPQV 154
gi 499191942 100 LIAESHRIRANYGLGFLGRAPDYMNANVMAAGAGAEYFNgcsaavpgdpkrDFAANMRRYYEYVQGNDLCLTHALTNPQV 179
gi 46196526   82 RRGQAYKLWADQNLGMMGRSPDYLNAVVMAYAASADYFG------------EFAENVRNYYRYLRDKDLATTHALTNPQV 149
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2YYG_A       150 NRARPPSGQPDPYIPVGVVKQTEKGIVVRGARMTATFP-LADEVLIFPSTLLQAGSEK--YALAFALPTSTPGLHFVCRE 226
gi 22778559  155 NRAKIQAEQKDANVALHVVEKNDDGVIVDGIRLLATQAgITDEIFVFPSTVVKSGAKDdpYSLAFAIANNTPGLRYLSRE 234
gi 499191942 180 NRSKMASELPDPYIALGIVEETDEGVIVRGARMMATLP-IADEILIFPSTVLKENADKsrYAMGFGIPTNTPGLSFQCRE 258
gi 46196526  150 NRARPPSGQPDPYIPVGVVKQTEKGIVVRGARMTATFP-LADEVLIFPSTLLQAGSEK--YALAFALPTSTPGLHFVCRE 226
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2YYG_A       227 ALVGGDSPFDHPLSSRVEEMDCLVIFDDVLVPWERVFILGNVELCNNAYAATGALNHMAHQVVALKTAKTEAFLGVAALM 306
gi 22778559  235 SFDYGKNNFDHPVGSQFEEGDAIVAFDNVLVPWDRIFILEDSEICNGAFAETNAVVHMSHQVIAKDIAKVEFLLGVVLKL 314
gi 499191942 259 PIDVGRDPEDHPLSSRFDEQDAFVIFDDVLVPWERIFLLYDVELANKAYAGTDAVLHMAYQVVNLKIAKTEAFLGTAQSI 338
gi 46196526  227 ALVGGDSPFDYPLSSRVEEMDCLVIFDDVLVPWERVFILGNVELCNNAYAATGALNHMAHQVVALKTAKTEAFLGVAALM 306
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2YYG_A       307 AEGIGADVYGHVQEKIAEIIVYLEAMRAFWTRAEEEAKENAYGLLVPDRGALDGARNLYPRLYPRIREILEQIGASGLIT 386
gi 22778559  315 MDSIGIDGFQHVKDKGTEIMLALENMKSHLYKAEYNAKIDRWGMMTPDFEALNAARNWFPRVYPRLAEILRVLGASGLMG 394
gi 499191942 339 VNAIGSGGFQHVQAKIAEIIIMLEIMKALEVAAREQAEPNDYGVMTPARAPLDAARNYYPANHARLPELLQLLGASGIIM 418
gi 46196526  307 AEGIGADVYGHVQEKIAEIIVYLEAMRAFWTRAEEEAKENAYGLLCPDRGALDGARNLYPRLYPRIREILEQIGASGLIT 386
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2YYG_A       387 LPSEKDFK-GPLGPFLEKFLQGAALEAKERVALFRLAWDMTLSGFGARQELYERFFFGDPVRMYQTLYNVYNKEPYKERI 465
gi 22778559  395 IPTYDDFAnKELGPILNRAMQGKNVEGFERVQLFRLAWDMTMSSFGSRQTHYEYYFFGDPVKMGMAYFDNYDKEPYKAMV 474
gi 499191942 419 MPSKADRE-GPLGPQIAKYLQTGNANADERLRLFRLAWDMSMSSFAGRQELYERYFFGDPVRMHSALYEVYDSSEAVARI 497
gi 46196526  387 LPSEKDFK-GPLGPFLEKFLQGAALEAKERVALFRLAWDMTLSGFGARQELYERFFFGDPVRMYQTLYNVYNKEPYKERI 465

                 ....*..
2YYG_A       466 RAFLKES 472
gi 22778559  475 DEFLESQ 481
gi 499191942 498 GEFLQRK 504
gi 46196526  466 RAFLKES 472
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap