Conserved Protein Domain Family
HpaI

?
TIGR02311: HpaI 
2,4-dihydroxyhept-2-ene-1,7-dioic acid aldolase
This model represents the aldolase which performs the final step unique to the 4-hydroxyphenylacetic acid catabolism pathway in which 2,4-dihydroxyhept-2-ene-1,7-dioic acid is split into pyruvate and succinate-semialdehyde. The gene for enzyme is generally found adjacent to other genes for this pathway organized into an operon.
Statistics
?
PSSM-Id: 131364
View PSSM: TIGR02311
Aligned: 6 rows
Threshold Bit Score: 417.25
Threshold Setting Gi: 36959089
Created: 8-Oct-2014
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33567327    8 NTFKAALRQGQVQIGLWVGLADPYAAEAVAGAGYDWLLIDGEHAPNDVRQMLSQLQAVAPYPVHPVVRPVIGDVPLIKQI 87
gi 12721924    3 NHFKQALKEKKPQIGLWVGLADGYACELAATAGFDWLLLDGEHAPNDLRTLLHQLQTLAAYPTTPIIRPVIGQTHTIKQL 82
gi 45436304   12 NKFKQALKAKKPQIGLWLGLCSNYSAEILAGAGFDWLLIDDEHAPNDVQRILGQLQTIASYPSQPVVRPAWNDPVMIKKL 91
gi 36959089    6 NRFKQKLLAGQSQIGLWCGLPGSYAAEIVALSGFDWLLFDTEHSPGDVLTVLPQLQAVASYDVSPVVRPAINDPVLIKRF 85
gi 37198511    7 NQFKQQLHEPQTLWGLWLGLPDTSCAEICGSAGFDWVLIDGEHASFDLTSIKLHLQALAPHSASPIVRAEEANPTLIKRL 86
gi 493050271   6 NQFKAALKQGRAQIGLWQALANPYTVEICAGAGYDWLLLDGEHAPNDVPLLVSQLQAMTGSASHPVVRPPVGETWIVKQL 85
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33567327   88 LDIGAQTLLVPVVESAEEAATMVAATRYPPRGIRGVGSALARSSRWNQIPDYLHKADEEMCVLVQVETRAGMEQLDAITQ 167
gi 12721924   83 LDIGAQTLLVPMVETAEQARELVKAIHYPPKGVRGVGSALARASRWNSIPHYLQQADEEICLLVQVENKTGLQNLKEIAE 162
gi 45436304   92 LDIGAQTLLLPMIQNAAQARAAISATRYPPQGIRGVGSALARASRWNRIADYVQQADEQICVLLQIETREALRNLPEILA 171
gi 36959089   86 LDIGVQTLLVPYVQNAEEAKAAVAAVRYPPDGIRGV-SALTRATRFGRVANYAQNAEREICLLLQVETREALGNLEPIAS 164
gi 37198511   87 LDIGAQTLLLPMINTKQQAEQAVRASYYPPMGERGIGAALARASQWNRIPNYLHQANEQISVLLQVETQQAIDNIEEIAA 166
gi 493050271  86 LDIGAQTLLIPMIESREQAEAMVKAMRYPPHGVRGVGSALARASAFNRIPDYLQTANDEVCLLLQVESRAGLANLDAIAT 165
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33567327  168 VEGVDGVFFGPADLSASMGHLGNPGHPDVQAAILDAIRRVRAAGKAPGILTADVKLARQYIEAGALFVAVGVDTTLLVRG 247
gi 12721924  163 VDGVDGVFIGPADLSASLGHLGNPSHPEVQQAIEQAIATICAADKAAGILYADEKMAKHYLALGCTFVAVGVDTSLLMRA 242
gi 45436304  172 VDGVDGVFIGPADLASDMGFAGNPHHPEVRQAIDSAVMKIKTADKAAGILMTTPEVAEYYLKLGALFVAVGVDTTLLART 251
gi 36959089  165 VEGVDGVFVGPADLAASFGHRGQPSHPEVVDAIVDAIERLKALGKPAGILTPDEKFAARCIAMGTLFTAVGVDVAVLARG 244
gi 37198511  167 VEGVDGIFIGPSDLSGSMGHIGNPSHPEVVAAIDQAIEVIQAHGKAVGILSLDPAQAQQYAKRGVKFIGAGVDTLLLRAG 246
gi 493050271 166 TEGVDGVFIGPADLAADMGHLGKPGAQEVQDAVRDALQRIIGHGKAAGILTGDLSLARHYLDLGATFVAIGNDVTLLANA 245

                 ....*....
gi 33567327  248 ARDLVRQFK 256
gi 12721924  243 LNDLSQKFK 251
gi 45436304  252 AEALAARFG 260
gi 36959089  245 SEALAARFA 253
gi 37198511  247 AESLAQSLK 255
gi 493050271 246 TTRLLADFK 254
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap