Conserved Protein Domain Family
HpaH

?
TIGR02312: HpaH 
2-oxo-hepta-3-ene-1,7-dioic acid hydratase
This model represents the enzyme which hydrates the double bond of 2-oxo-hepta-3-ene-1,7-dioic acid to form 4-hydroxy-2-oxo-heptane-1,7-dioic acid in the catabolism of 4-hydroxyphenylacetic acid. The gene for this enzyme is generally found adjacent to other genes of this pathway in an apparent operon.
Statistics
?
PSSM-Id: 131365
View PSSM: TIGR02312
Aligned: 8 rows
Threshold Bit Score: 488.464
Threshold Setting Gi: 23464539
Created: 8-Oct-2014
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33567326    1 MLSEALIGELAAQLYESERTRVQVEHFSKRHPEITIEDGYRISRAWVAMQRADGRRVIGHKIGLTSRAMQQASQIDEPDY 80
gi 12721923    1 MLSEAIIQQAAQRLNEAEKTGTQISQFSLAYPEITIEDAYEIQKAWVAMKIAEGRVLKGHKIGLTSKAMQNSSQINEPDY 80
gi 33568167    3 VLDDALLDTLARELYEAEQTRTPIRQLSLRHPALTIEDAYAIQRKWVALKIAAGNPLKGHKIGLTSRAMQAAIGIDEPDY 82
gi 3378445     5 AFSDILVNELALELDGAEQTRERVRPFSARYPAMRIEDAYRINQAWVDLKLARGRTVCGHKIGLTSRAMQQAAGITEPDY 84
gi 23330202    1 MLDDATIRELAAELHEAERSGVQTKQFSQRFPDIAFEDSYRVQREWMRIKLAEGRRKIGRKIGLTSRAMQKIANITEPDY 80
gi 23464539    1 MLTKDEIEAAAAALDGAEKTRRQVGLLSLKHPGMTMDDAYAVQAAWVKQKIAAGRRVIGWKIGLTSKAMQYALNIDIPDS 80
gi 37198510    1 MLTKEQLQEAAERLYHAEKQREQISALTLQYPEMTMDDAYQIQSEWVGRKVSEGAQVKGYKIGLTSRAMQMAVNIDQPDY 80
gi 499191842   1 MLTDEQIRDAAHRLQEAETNRRQIGHLSRQYPDITIEDAYRVQDAWVSHKLAQGRRVYGHKIGLTSRAMQKSSNINEPDY 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33567326   81 GTLLDHMLYTCqpGQelAIPFERFIAPRVEVELAFVLKAPLRGPEVTVEQVLAATEYVTPAIEIIDSRIEQFDRHTRAMR 160
gi 12721923   81 GALLDDMFFEE--NS--EIPFDRFIVPRVEVELAFILKKDLSGPNCTIFDVLDATDYVIPALEIIDARIEQFDSKTKVPR 156
gi 33568167   83 GALLDDMFFAD--GT--TIPAGRFIAPRVEVELAFIMGRRLEGPDVTLFDVLEAARYVTPALEILDARVQMVDPQTRATR 158
gi 3378445    85 GTLLDDMVFEQ--GS--DVPAARFITPKVEVELAFVLGRRLEGAQTTIFDVLSATDYVVPAIEIIDTRVHPKDAETGAAR 160
gi 23330202   81 GVLLDDMVIAD--GS--TVAPGRFIQPFVEVELAFVLNKDLGGPDVSIFDVLGATEWVVPAVEIIDARIERIDPETGSQR 156
gi 23464539   81 GVLLDDMAFED--GA--VIPADRFIQPRIEAEIAFTMKAPLKGPNVSVFDVLNATDYITPALEILDTRILRVDPETKKTR 156
gi 37198510   81 GVLLDDMFFPD--GA--QIKADDFLDPRIEVELAFVLKEKLEGDGVTIFDVLNATDYVVPALELIAARCHRTDPNTGYTR 156
gi 499191842  81 GVLLDDMVFAE--GS--EIPAGRFIVPRVEVELAFLLDKDLSGPHCTVFDVLGATAYVFPAIEIIDARIQQLDPETKATR 156
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33567326  161 KVFDTISDNAANAGVVTGAQRVSPQALDLPWCGAVLRQNGVVEETGLAAGVQGHPAIGVAWLANKLAPWGETLEPGQLVL 240
gi 12721923  157 RVFDTISDNAANAGVVLGGRAIKPMDVDLRRVAAVLYRNGVVEESGVSAAVLNNPIKGVAWLANKLHPYGVTLKAGEVIL 236
gi 33568167  159 KVTDTISDNAANAGVVLGGRPVRVDEVDLRRVGAILMRNAVVEETGLAAGVLNHPANGVAWLARKLSAHGIALEKDQVIM 238
gi 3378445   161 KVLDTISDNAANAGIIVGGLPAKPDGLDLRRIGALLSRNGVIEETGLAAGVLNHPANGVAWLVRRLAPWGQALEAGEVVL 240
gi 23330202  157 RVLDTIADNAANAGIVVGSSPVRPDALDLRWVGVTLLKNSVVEETGVGAGVLNHPAKGIVWLARKLSAWDEYLAAGELVL 236
gi 23464539  157 SIVDTISDNAANAGIVIGGRQMRADQVDMRWMGAIVSRNAQMEETGLGAGVLNHPARGIVWLANRLALYGEGIEAGQIVL 236
gi 37198510  157 KVYDTIADNAANAGIILGGRPIKPTEFDLRWAGAMLYLNGQIEETGLAAGVLGHPANGICWVCKRFAPHGVSLEPGQVIL 236
gi 499191842 157 KVFDTISDNAANAGIVTGGRPVRPFDFDLRWLGALLYKNGVIEETGVAAGVLNHPANGVAWLANKYAAHGRRLEAGQVIL 236
                        250       260       270
                 ....*....|....*....|....*....|.
gi 33567326  241 AGSFTRPVAARKGDAFEADYGPLGAMRFRFV 271
gi 12721923  237 GGSFTRPVAARRGDTFHVDYHELGSISMQFV 267
gi 33568167  239 AGSFTRPVHAASGDTLSADYGPLGTVSCHFA 269
gi 3378445   241 GGSFTRPVEAAPGDVFNADFGEFGSIGFRFV 271
gi 23330202  237 AGSFTRIVPVESGDQICADYGPLGTINVRFE 267
gi 23464539  237 AGSFIRPVEARHGDTINADFGPYGTIACHFL 267
gi 37198510  237 AGSFTRPVAVKAGDTIHADFGPLGGISVKFV 267
gi 499191842 237 AGSFTRPVEADPGDVFHADYGPLGGVTLRFG 267
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap