1MUM


Conserved Protein Domain Family
prpB

?
TIGR02317: prpB 
Click on image for an interactive view with Cn3D
methylisocitrate lyase
Members of this family are methylisocitrate lyase, also called (2S,3R)-3-hydroxybutane-1,2,3-tricarboxylate pyruvate-lyase. This enzyme acts in propionate metabolism. It cleaves a carbon-carbon bond to convert 2-methylisocitrate to pyruvate plus succinate. Some members of this family have been annotated, incorrectly it seems, as the related protein carboxyphosphoenolpyruvate phosphomutase, which is involved in synthesizing the antibiotic bialaphos in Streptomyces hygroscopicus.
Statistics
?
PSSM-Id: 131370
View PSSM: TIGR02317
Aligned: 10 rows
Threshold Bit Score: 437.594
Threshold Setting Gi: 39649314
Created: 8-Oct-2014
Updated: 23-Jan-2015
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1MUM_A         5 PGKAFRAALTKENPLQIVGTINANHALLAQRAGYQAIYLSGGGVAAgSLGLPDLGISTLDDVLTDIRRITDVCSLPLLVD 84
gi 23396814   13 RRQAFKAALAAPHIARLPGAFSPLIARSIEEAGFEGVYVSGAVIAA-DLALPDIGLTTLTEVAHRARQIARVTDLGVLVD 91
gi 39576137   11 KRKNFRDALKSGKLLQMPGSWSPLVSMAIEKAGFDGVYISGSVLSN-DLGYPDIGLTSLTEVAQRGRQIARTTKLPTIID 89
gi 150421531  12 PGLVLRELIEKRDIVVAPGVYNPAVALLAERMGFEALYLSGAAITG-SLAMPDLGLITLSELAMFTSYITRVVRVPVIVD 90
gi 10640537   11 GPATLRDLIKK-DIVVAPGVFSGISALMAERAGFQASYLSGSGVAG-MMGLPDLSVTTLPEIAAEAYRITTVSSLPLIVD 88
gi 1731059    14 LAGRFRKLMSAPDILQIPGAHDGMAALLAKEAGFSAIYLSGAAYTA-SRGLPDLGIITSAEIAERAKDLVRAADLPLLVD 92
gi 39649314   14 AGVRFRSLIERGGIVRMPGAHNGMAALQARAAGFEALYLSGAAMTA-SMGIPDLGMITVDEVTFFIRQIARAGGLPTLVD 92
gi 29541367    3 PGKLFRQAVANEHPLQIVGAINAYCALLAENVGFKAIYLSGGGVAN-TLGLPDLGITDLHDVLEDARRITAATHLPLLVD 81
gi 32261945    4 QGIKLREAVAQNNPLQIIGVINAYSAIQAQKSGAKALYLSGGALAAmSLGVPDLGISSLEDVCIDVRRITAASDLPLLVD 83
gi 2498804     6 PGKAFRAALTKENPLQIVGTINANHALLAQRAGYQAIYLSGGGVAAgSLGLPDLGISTLDDVLTDIRRITDVCSLPLLVD 85
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1MUM_A        85 ADIGFGSsAFNVARTVKSMIKAGAAGLHIEDQVGAKRCGHRPNKAIVSKEEMVDRIRAAVDAK-TDPDFVIMARTDALAV 163
gi 23396814   92 ADTGFGE-PMSAARTVAELEDAGVAGCHLEDQVNPKRCGHLDGKEVVRTDVMVRRIAAAVSAR-RDPNFVICARTDAAGV 169
gi 39576137   90 IDTGFGE-PMSATRTVQEMIEMGLAGCHIEDQINPKRCGHLDGKGLVTRDEAARKVAAAARGKkMDENFLLIARTDARAV 168
gi 150421531  91 ADTGFGE-AINVERTVRELERAGAAAIQIEDQVMPKKCGHLQGKALISPEDMVKKIIAAVGAR-R--DALIVARTDARGV 166
gi 10640537   89 VDTGFGE-TVNVMRTVRMMEDAGAAAIHIEDQEQPKKCGHLNGKRVIDRDNMVRKIRAAVSTR-KDEDFMIIARTDARSV 166
gi 1731059    93 IDTGFGG-VLNAARTAREMLEARVAAVQMEDQQLPKKCGHLNGKQLVPIKEMAQKIKAIKQAA-P--SLIVVARTDARAQ 168
gi 39649314   93 GDTGYGE-ALNVMHMVRTFEDAGAGAVHIEDQLLPKKCGHLNDKKLADANDMAAKVAAAAKAR-R--HLYLIARTDAAAS 168
gi 29541367   82 IDTGFGG-AFTIARAIKEMERAQVAAVHMEDQVAQKRCGHRPGKELVNTNEMVDRIKAAVDVK-SND-FVLIARTDAYAV 158
gi 32261945   84 ADTGWGG-AFNIARTIKDLTRSGAAGCHIEDQVAQKRCGHRPNKELVSLEEMCDRIKAGVDAK-IDENFVLMARTDAHAS 161
gi 2498804    86 ADIGFGSsAFNVARTVKSMIKAGAAGLHIEDQVGAKRCGHRPNKAIVSKEEMVDRIRAAVDAK-TDPDFVIMARTDALAV 164
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1MUM_A       164 EGLDAAIERAQAYVEAGAEMLFPEAITELAMYRQFADAVQ-VPILANITEFGATPLFTTDELRSAHVAMALYPLSAFRAM 242
gi 23396814  170 EGIDAAIERAKAYLDAGADMIFTEALHSEADFRYFRHAIPdALLLANMTEFGKTTLLSADVLEEIGYNAVIYPVTTLRIA 249
gi 39576137  169 EGLDKAIDRAKAYIDAGADCIFTEALENEKEFETFRKAVn-VPLLANMTEFGKGRLYTYEELSNLGYNIVIYPVTTFRLA 247
gi 150421531 167 EGFEKAVERAQLYVEAGADIIFPEALTSLEEFREFARRVK-APLLANMTEFGKTPYITVDQFREAGYKIVIFPVTTFRAS 245
gi 10640537  167 NGLEDAIDRANAYLEAGADAVFTEALESREEFVEMRKKVK-GYLMANMTEDGKSPLLSVAELREIGYDIVIFPLTAFRGM 245
gi 1731059   169 EGLDAAIKRSEAYIEAGADAIFPEALQAENEFRQFAERIP-VPLLANMTEFGKTPYYRADEFEDMGFHMVIYPVTSLRAA 247
gi 39649314  169 EGIDGAVARAKLYIEAGADAIFPEALTTAEMFREFAARMPgVPLLANMTEFGRTPFFTADEFQQMGYRMVIWPVSSLRVA 248
gi 29541367  159 EGLKATIDRACTYVEAGADMIFAEALENINDYPTFCKAVK-VPVLANMTEFGKTPLYTAAQLADHGVKMVLYPRSADRAM 237
gi 32261945  162 EGQNRAIERALAYVEAGADMIFAEAIHTLEEYKQFTQNIK-VPVLANITEFGKTPYFTTSELQNVGVKMVLYPLSAARAM 240
gi 2498804   165 EGLDAAIERAQAYVEAGAEMLFPEAITELAMYRQFADAVQ-VPILANITEFGATPLFTTDELRSAHVAMALYPLSAFRAM 243
                        250       260       270       280
                 ....*....|....*....|....*....|....*....|....*....
1MUM_A       243 NRAAEHVYNVLRQEGTQKSVIDTMQTRNELYESINYYQYEEKLDNLFAR 291
gi 23396814  250 MGQVEQALAEIKEHGTQEGWLDRMQHRSRLYELLRYEDYNVFDQHIFTY 298
gi 39576137  248 MGATVAGLNEIKAKGTQEGLLDKMQTRKDLYALSRYDEYNSFDTSIFNF 296
gi 150421531 246 LKASETVLREIMEKGTQKDILDKLYTRTEFYDLIGYHDYEKRDAEVSRK 294
gi 10640537  246 LKAIGDIYRDLLKDGTQRNFLDRIMRRSEFYDVIGYYDYEKEDNVFYKI 294
gi 1731059   248 AKACERMFGLMKEHGSQKEGLHDMQTRKELYDTISYYDYEALDKTIAKT 296
gi 39649314  249 NKVQQKLYATLHRDGSTQAMLGDMQTRAELYETLGLDRFEALDASIVRS 297
gi 29541367  238 SKAALAVYEDIKKHGVQTASLPFMQTREALYEVLNYHAYEDKLNQLFKR 286
gi 32261945  241 NKAALTVFQDIIKNGSQKQSIDSMQTRDELYEMLGYHTFEKKLDELFKH 289
gi 2498804   244 NRAAEHVYNVLRQEGTQKSVIDTMQTRNELYESINYYQYEEKLDNLFAR 292
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap