Conserved Protein Domain Family
CPEP_Pphonmut

?
TIGR02319: CPEP_Pphonmut 
carboxyvinyl-carboxyphosphonate phosphorylmutase
This family consists of carboxyvinyl-carboxyphosphonate phosphorylmutase (CPEP phosphonomutase), an unusual enzyme involved in the biosynthesis of the antibiotic bialaphos. So far, it is known only in that pathway and only in Streptomyces hygroscopicus. Some related proteins annotated as being functionally equivalent are likely misannotated examples of methylisocitrate lyase, an enzyme of priopionate utilization.
Statistics
?
PSSM-Id: 131372
View PSSM: TIGR02319
Aligned: 2 rows
Threshold Bit Score: 568.977
Threshold Setting Gi: 47149
Created: 8-Oct-2014
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                      10        20        30        40        50        60        70        80
              ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 114878   2 AVTKARTFRELMNAPEILVVPSAYDALSAKVIQQAGFPAVHMTGSGTSASMLGLPDLGFTSVSEQAINLKNIVLTVDVPV 81
gi 47149    2 AVTKARTFRELMNAPEILVVPSAYDALSAKVIQQAGFPAVHMTGSGTSASMLGLPDLGFTSVSEQATNAKNIVLAVDVPV 81
                      90       100       110       120       130       140       150       160
              ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 114878  82 IMDADAGYGNAMSVWRATREFERVGIVGYHLEDQVNPKRCGHLEGKRLISTEEMTGKIEAAVEAREDEDFTIIARTDARE 161
gi 47149   82 IMDADAGYGNAMSVWRATREFERVGIVGYHLEDQVNPKRCGHLEGKRLISTEEMTGKIEAAVEAREDEDFTIIARTDARE 161
                     170       180       190       200       210       220       230       240
              ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 114878 162 SFGLDEAIRRSREYVAAGADCIFLEAMLDVEEMKRVRDEIDAPLLANMVEGGKTPWLTTKELESIGYNLAIYPLSGWMAA 241
gi 47149  162 SFGLDEAIRRSREYVAAGADCIFLEAMLDVEEMKRVRDEIDAPLLANMVEGGKTPWLTTKELESIGYNLAIYPLSGWMAA 241
                     250       260       270       280       290
              ....*....|....*....|....*....|....*....|....*....|....
gi 114878 242 ASVLRKLFTELREAGTTQKFWDDMGLKMSFAELFEVFEYSKISELEARFVRDQD 295
gi 47149  242 ASVLRKLFTELREAGTTQKFWDDMGLKMSFAELFEVFEYSKISELEARFVRDQD 295
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap