Conserved Protein Domain Family
CP_lyasePhnL

?
TIGR02324: CP_lyasePhnL 
phosphonate C-P lyase system protein PhnL
Members of this family are the PhnL protein of C-P lyase systems for utilization of phosphonates. These systems resemble phosphonatase-based systems in having a three component ABC transporter, where TIGR01097 is the permease, TIGR01098 is the phosphonates binding protein, and TIGR02315 is the ATP-binding cassette (ABC) protein. They differ, however, in having, typically, ten or more additional genes, many of which are believed to form a membrane-associated C-P lysase complex. This protein (PhnL) and the adjacent-encoded PhnK (TIGR02323) resemble transporter ATP-binding proteins but are suggested, based on mutatgenesis studies, to be part of this C-P lyase complex rather than part of a transporter per se.
Statistics
?
PSSM-Id: 131377
View PSSM: TIGR02324
Aligned: 8 rows
Threshold Bit Score: 338.982
Threshold Setting Gi: 40787176
Created: 8-Oct-2014
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 34103152    4 LIDAQNLSKTFTLHQQGGLRLPVLTEVSLQAAAGECVALAGPSGAGKSTLLKALYANYLVENGRVG--VL-HQGAWVDMA 80
gi 27349477    8 MIDVTDAKKTFTMHLQGGIELPVVSGVTFQVNPGECVVLSGPSGAGKSSILKMIFGNYRCDSGRIG--IR-HRGALIDLA 84
gi 14027952    4 RLHAKGLAKTFTLHTQGGTILPVFDNIELAVKAGECVCLHGPSGAGKSTLLRSLYANYKPDAGKIL--VQ-HIGDTVDLL 80
gi 28853000    4 LIEVRDLSKTFTLHQHNGVVLNVLRGLSFSVRSGECLMLSGQSGAGKSTLLRTLYGNYLPAAGSIR--VQ-HEGEWTELV 80
gi 499305600  18 LLQVENLRKSFILHQQGGMNLSVLEDVSLSVNAGECVALSGASGSGKSTFMRCLYANYRVDSGSVW--VR-HEESWLDLC 94
gi 446534059   1 MINVQNVSKTFILHQQNGVRLPVLNRASLTVNAGECVVLHGHSGSGKSTLLRSLYANYLPDEGQIQ--IK-HGDEWVDLV 77
gi 499377798   3 LLEVSDFGKQFINHRLQ-VKRQAVKNIHFTLEEGQFLGIIGKSGSGKSTILKSIYRTYLPDQGTIYfdSN-HLGK-IDIT 79
gi 489209538   5 ILKIEGLSKQFQLHDQN-KLIPSCAQVQLEVFAGELTALIGPTGAGKSSVLKAIYRTYLPSSGRIL--YRdANGAITDLA 81
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 34103152   81 RALPHEIAAVRRHTLGYVSQFLRVIPRVSALDIVTEPLREWGAADAEARLAAGEWLARLNIAERLWSLPPATFSGGEQQR 160
gi 27349477   85 TAEPRQVLNVRRATIGYVSQFLRAVPRVATIDVVAEPLIVNGMARTEAQQRAGALLHRLNIPERLWQLPPATFSGGEQQR 164
gi 14027952   81 AAEPWEVVEIRRRTIGYVSQFLRVIPRVPTLDIVAEPAIVNGVPPEKAHAAARALLSRLRIPERLWSLAPATFSGGEQQR 160
gi 28853000   81 GATPRQVLEVRRKTLGYVSQFLRVIPRVSSLDVLMEPALARGWSREQAQARAQLLLTRLNIPQRLWPLAPSTFSGGEQQR 160
gi 499305600  95 QLAPHEILAVRQKTIGYVSQFLRVIPRVPALEVAAEPLLELGINIDVAYNKVKDLFRRLNLSERLWHLSPTTFSGGEKQR 174
gi 446534059  78 TAPARKVVEIRKTTVGWVSQFLRVIPRISALEVVMQPLLDTGVPREACAAKAARLLTRLNVPERLWHLAPSTFSGGEQQR 157
gi 499377798  80 KISEREMIYLRKFEISYVSQFLDVLPRITCRELVEKSLQEMGVEHAIARVEAESALNHFEIDEKLWDVYPNTFSGGEKLR 159
gi 489209538  82 QASEHRMLELRKQDLGFVTQFLHCLPRKSAVEVVAEPLVQRGSPREAAAERARELLALLNVPERLWAVPPATFSGGEKQR 161
                        170       180       190       200       210       220       230
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|...
gi 34103152  161 VNIARGMIAPRPILLL-DEPTASLDAANREVVVQLMREALARRAALIGIFHD-APTRDAI-ATR--VF-QVPL 227
gi 27349477  165 VNIARGFISDLPILLL-DEPTASLDAANRAVVVELIAEKKRQGVAMVAIVHD-DEIRHLI-ADR--IV-DVTS 231
gi 14027952  161 VNIARSFIADYPVLLL-DEPTASLDATNRQTVIELINEAKARGAAIVGIFHD-EEVREAV-ADR--LF-EVTP 227
gi 28853000  161 INIARAFMVPWPVLLL-DEPTASLDDANRKVVLELVAEAKQAGAALIGIFHD-RDARESV-ADR--QL-DMTP 227
gi 499305600 175 VNITRALAVDYPILLL-DEPTSALDTTNRQVVIELLQEKKAQGCALIGIFHD-EEVKAQL-CNR--EL-IFKS 241
gi 446534059 158 VNIARGFIVDYPILLL-DEPTASLDAKNSAAVVELIREAKTRGAAIVGIFHD-EAVRNDV-ADRlhPM-GASS 226
gi 499377798 160 LNIAMATVK-QPRLLLlDEPTASLDQNSKIKVREVIEKLKHSGTTLIGIFHDiEFIEGLCdSIF--NMnDHQP 229
gi 489209538 162 VNLARGLIARPRLLLL-DEPTASLDPSTTDRVVELLKSIKAEGVAMLAIFHD-PELVRRL-ADR--VV-TLTP 228
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap