Conserved Protein Domain Family
C_P_lyase_phnF

?
TIGR02325: C_P_lyase_phnF 
phosphonates metabolism transcriptional regulator PhnF
All members of the seed alignment for this family are predicted helix-turn-helix transcriptional regulatory proteins of the broader gntR and are found associated with genes for the import and degradation of phosphonates and/or related compounds (e.g. phosphonites) with a direct C-P bond. [Transport and binding proteins, Anions, Regulatory functions, DNA interactions]
Statistics
?
PSSM-Id: 131378
View PSSM: TIGR02325
Aligned: 5 rows
Threshold Bit Score: 344.845
Threshold Setting Gi: 27349471
Created: 8-Oct-2014
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23347927    8 IERNSGVAIWRQIADEIRSDIMAGKLQPGARMPAEIELAEHFGVNRHTVRNAIAALTQEGVLRAEQGRGTFIAnAKRLTN 87
gi 34103158    2 IERGSGVAVWRQIEETLAADIAAGALHAGQQLPTELQLADRFGVNRHTIRRAVATLVERGLLRVEQGRGTFVQ-DNAIDY 80
gi 27349471    5 DTASTGVALWRLVADGIERGIADGRFAAGDKLPGEMEIAETYRVNRHTVRRALAALAERGLVRAERGSGTYVE-AQRIAY 83
gi 130096      5 THPTSYPTRYQEIAAKLEQELRQ-HYRCGDYLPAEQQLAARFEVNRHTLRRAIDQLVEKGWVQRRQGVGVLVL-MRPFDY 82
gi 499273317   7 MKRKNGVALWRQIADRIRGEIAAGDHDETGMLPPEMTLAEKFGVNRHTVRSAIAALASEGILEPMQGRGTMIArKERLSF 86
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23347927   88 QCTHPSRISQTFASQTRETKGILLASDLETASPEIASALELETGQEVVRLETLHSADGHPLSRATLWLDAARFPDIAVDY 167
gi 34103158   81 AISKRTRFSQNMARQNLSSDIDILQSDTMPANAELAGLLQVAVGDTLFRIKVLSKVENRVVDYATMFFPAARLPGLPDAY 160
gi 27349471   84 PLRSRTRFSEIVGAGGREPRGQLIEASDDVATRELARELGLKVGAPLVRIEAIRLADRTPICVSTTWLSAELFPGAGSVF 163
gi 130096     83 PLNAQARFSQNLLDQGSHPTSEKLLSVLRPASGHVADALGITEGENVIHLRTLRRVNGVALCLIDHYFADLTLWPTLQRF 162
gi 499273317  87 PISLRTRFTAGIGDQVKEMEALLLSHTTEPASADLAARLQLPSGAPLVRLETLRKADTRPVSRSTTWFPADRFAGIGEAY 166
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23347927  168 AESGSIAVALRKASIEEYFRKSTIISARHADADDRRYLKLSPGAIVLTAQAVKID-TEGRPVQYSLTRFPADRMEFSIEN 246
gi 34103158  161 LRHRSVTRALDDCGVADYTRRFTRVTARLPDAETVDYLGIPKNRPVLHVKSLNVD-GEGRPVQYGVTCFNGDLVQLVMEQ 239
gi 27349471  164 AATRSMTKLLEHFGVRDYRRGATRITAGIVDATDAARLDLPLGRPILVVDATDHG-LDGKPLVTKHSRFAAERVEFLVEN 242
gi 130096    163 D-SGSLHDFLREQTGIALRRSQTRISARRAQAKECQRLEIPNMSPLLCVRTLNHRdGESSPAEYSVSLTRADMIEFTMEH 241
gi 499273317 167 RKSGSITAAFKALGVADYVRISTVISAIHADTQDLADLELSPGAILLVTQALNAD-MDGVPVQYAVSRFSADTVEFTVEN 245
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap