Conserved Protein Domain Family
int_mem_ywzB

?
TIGR02327: int_mem_ywzB 
conserved hypothetical integral membrane protein
Members of this protein family are small, typically about 80 residues in length, and are highly hydrophobic. The gene is found so far only in a subset of the Firmicutes in association with genes of the ATP synthase F1 complex or NADH-quinone oxidoreductase. This family includes ywzB from Bacillus subtilis; pfam06612 describes the same family as Protein of unknown function DUF1146.
Statistics
?
PSSM-Id: 131380
View PSSM: TIGR02327
Aligned: 5 rows
Threshold Bit Score: 58.8914
Threshold Setting Gi: 22533885
Created: 8-Oct-2014
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                       10        20        30        40        50        60        70
               ....*....|....*....|....*....|....*....|....*....|....*....|....*....|.
gi 22533885  5 IVTIVSNFIFIALFYqLFVDLFDWSKMIKmsPQNISKLKVFILLISIVGGYVVSHFLLEVIQLCQSIFWAL 75
gi 19747998 14 IIAFSCHLFFIGLSYqLLISVIDWTKFSHyhPENLGRLRLFVFLLATALGYLVSHCMLELIQISQTLFFEF 84
gi 46881971 10 YVIIISHLLFIVITF-WALQAINYEKFIK--KNHVTQARLLFVIISIVLGYTLSNFFLDYLAASKQLINFF 77
gi 47505998 10 LIAIVSHLLFITITW-WALQGIHIERLMK--PGKVMQTRVLLILITIAIGTSVSNFFLDYLGYSKSLTYLV 77
gi 29344557  9 IVRIVSHLMFIYISF-WALQSLRIEQFFK--TQFTPQIRMLMVFFAIAIGYTVSSFALELIALCRNLFIVY 76
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap