Conserved Protein Domain Family
TIGR02328

?
TIGR02328: TIGR02328 
conserved hypothetical protein
Members of this protein are found in a small number of taxonomically well separated species, yet are strongly conserved, suggesting lateral gene transfer. Members are found in Treponema denticola, Clostridium acetobutylicum, and several of the Firmicutes. The function of this protein is unknown. [Hypothetical proteins, Conserved]
Statistics
?
PSSM-Id: 131381
View PSSM: TIGR02328
Aligned: 4 rows
Threshold Bit Score: 215.083
Threshold Setting Gi: 15894853
Created: 8-Oct-2014
Updated: 11-Oct-2014
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 28272723    4 MRLWHEQLIHQLPRQQLLGQHRELAALRGNGWGKNHATVNYVFKYSPYKLYQFHVLVMDEMQLRGYHPNKIWYDPNYRGQ 83
gi 23095339    1 MRLWHQDIIELLPRQQLLGQHRECCALRGNGWGRKHETVDYVFRYSPYRLFAYHQLVMEEMMERGYRVSKEWLIAEYRGM 80
gi 489222331   6 MRLWHEALIKKLPRQQLLGQHRECCALRGKGWGKPHSTVNYVFNYSPYKLFQYHLQVMTEMRKRGYHPDEKWLNPLYRGQ 85
gi 499267490   1 MRLWHQSLITKLPRQQLLGQHRECCALRGNAWGKKHSVVDYVFCHPMEYLVAYHLLVMEEMATRNYNVSDQWMDYNYRGK 80
                         90       100       110       120
                 ....*....|....*....|....*....|....*....|....
gi 28272723   84 FCP----PYDHLTPIALTTPIYPEHNASYLAECVRNLAAKGIIM 123
gi 23095339   81 KCP----RYDTLNPVDLETPIYPEHNQDYLQECLWNLKAKGIDL 120
gi 489222331  86 TSK----VYLELEEVIQTFPIYPEHNNDYLEDCKENLREKGIII 125
gi 499267490  81 NCEkanlNFELIEEIKASKNIYKEHDDEYLNECLANLRNKGIEL 124
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap