1SZQ


Conserved Protein Domain Family
prpD

?
TIGR02330: prpD 
Click on image for an interactive view with Cn3D
2-methylcitrate dehydratase
Members of this family are bacterial proteins known or predicted to act as 2-methylcitrate dehydratase, an enzyme involved in the methylcitrate cycle of propionate catabolism. A related clade of archaeal proteins that may or may not be functionally equivalent is reserved for a future model and is excluded from this family. The PrpD enzyme of E. coli is responsible for the minor aconitase activity (AcnC) not accounted for by AcnA and AcnB.
Statistics
?
PSSM-Id: 131383
View PSSM: TIGR02330
Aligned: 5 rows
Threshold Bit Score: 876.484
Threshold Setting Gi: 48425743
Created: 8-Oct-2014
Updated: 23-Jan-2015
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1SZQ_A        13 DREIVDIVDYVXNYEISSKVAYDTAHYCLLDTLGCGLEALEYPACKKLLGPIVPG-TVVPNGVRVPGTQFQLDPVQAAFN 91
gi 32261947   16 DELLSKIARYALEFEINSPLAYETARYCLMDTIGCGLLALNFPACTKLLGPVVEGaEFRPLGAKIPGTSYQLEPERAAFN 95
gi 2497946    13 DREIVDIVDYVMNYEISSKVAYDTAHYCLLDTLGCGLEALEYPACKKLLGPIVPG-TVVPNGVRVPGTQFQLDPVQAAFN 91
gi 489193727  14 DAVLQDIADYVLDYRIDSTEALDTARNCLMDTLGCGLLALRFPECTKHLGPLVEG-TLVPHGARVPGTSFRLDPVKAAWD 92
gi 47502792   11 DAILEEITDYVLNKEVTSAEAFSTARYVLFDTLGCGILALQYPECTKLLGPVVPG-TIVPNGTRVPGTSYVLDPVKGAFN 89
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1SZQ_A        92 IGAXIRWLDFNDTWLAAEWGHPSDNLGGILATADWLSRNAVASGKAPLTXKQVLTAXIKAHEIQGCIALENSFNRVGLDH 171
gi 32261947   96 VGAMVRWLDFNDTWLAAEWGHPSDNLGAIWAVADYLSRKNIAQGKEPLRVKDVLSAMIKAHEIQGILALENCFNKVGLDH 175
gi 2497946    92 IGAMIRWLDFNDTWLAAEWGHPSDNLGGILATADWLSRNAVASGKAPLTMKQVLTAMIKAHEIQGCIALENSFNRVGLDH 171
gi 489193727  93 IGCIVRWLDYNDTWLAAEWGHPSDNLGGILAVADHLSQKRLANGEAPLSMRQVLEAMIMAHEIQGVIALENSFNRVGLDH 172
gi 47502792   90 IGCMIRWLDYNDTWLAAEWGHPSDNLGGILAVADYISRVRISEGKEPLKVREVLEMMIKAHEIQGVLALENSLNRVGLDH 169
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1SZQ_A       172 VLLVKVASTAVVAEXLGLTREEILNAVSLAWVDGQSLRTYRHAPNTGTRKSWAAGDATSRAVRLALXAKTGEXGYPSALT 251
gi 32261947  176 VLLVRIASTAVACAMLGGNFEEVRNAISHAFIDGGALRTYRHAPNTGSRKSWAAGDASSRGVNLALKALSGEMGYPSALS 255
gi 2497946   172 VLLVKVASTAVVAEMLGLTREEILNAVSLAWVDGQSLRTYRHAPNTGTRKSWAAGDATSRAVRLALMAKTGEMGYPSALT 251
gi 489193727 173 VLLVKVASTAVCAKLMGADREQLLAALSHAFVDGQALRTYRHAPNAGSRKSWAAGDATSRGVRLADIALRGEMGIPGVLS 252
gi 47502792  170 VLYVKVATTAVVAKMLGGTREEIFNALSHAWIDNSSLRTYRHAPNTGSRKSWAAGDATSRGVHLAMTALKGEMGYPTALS 249
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1SZQ_A       252 APVWGFYDVSFKGE------------SFRFQRPYGSYVXENVLFKISFPAEFHSQTAVEAAXTLYEQXQAAgktAADIEK 319
gi 32261947  256 ASFWGFEDVKMKGQ------------KLTIPQEFGSYVMENVLFKISFPAEFHAQTAVECAIKLHNEVKNR---LDEIER 320
gi 2497946   252 APVWGFYDVSFKGE------------SFRFQRPYGSYVMENVLFKISFPAEFHSQTAVEAAMTLYEQMQAAgktAADIEK 319
gi 489193727 253 APQWGFYDVLFSHTskdlatkpedkrRFSFPQGYGSYVMENVLFKISFPAEFHAQTAAEAAVRLHPLVKDR---LQRISR 329
gi 47502792  250 APGWGFQDVLFNKQ------------ELKLARPLESYVMENVLFKVSYPAEFHAQTAAECAVKLHPEIKER---LDEIDR 314
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1SZQ_A       320 VTIRTHEACIRIIDKKGPLNNPADRDHCIQYXVAIPLLFGRLTAADYEDN-VAQDKRIDALREKINCFEDPAFTADYHDP 398
gi 32261947  321 IVITTQESGHRIINKVGPLANPADRDHCIQYMVAVPLVFGRLTAEDYEDS-VASDPRIDSLRDKMSVEVDDRYTREYLES 399
gi 2497946   320 VTIRTHEACIRIIDKKGPLNNPADRDHCIQYMVAIPLLFGRLTAADYEDN-VAQDKRIDALREKINCFEDPAFTADYHDP 398
gi 489193727 330 IVITTHESAIRIISKVGPLANPADRDHCLQYMTAVPLIFGDLVAEHYEDAfHAAHPLIDRLREKMEIVEEPRYSREYLEA 409
gi 47502792  315 ITITTHESAIRIIDKEGPLNNPADRDHCLQYITAIGLLKGDIVADDYEDA-VANDPRVDELRNKMVVVENKQYSLDYLDP 393
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1SZQ_A       399 EKRAIANAITLEFTDGTRFEEVVVEYPIGHARRRQDGIPKLVDKFKINLARQFPTRQQQRILEVSLDRARLEQXPVNEYL 478
gi 32261947  400 DKRSIANAVQIFYKDGSKSQKVEVEYPIGHKRRRDEGIPVLVDKFKRNIALKLSSKKCALIEKLCSDQKTLESTPFNEFS 479
gi 2497946   399 EKRAIANAITLEFTDGTRFEEVVVEYPIGHARRRQDGIPKLVDKFKINLARQFPTRQQQRILEVSLDRARLEQMPVNEYL 478
gi 489193727 410 DKRSIANAVEVFFDDGSSTGQVAVEYPLGHRRRRAEGIPLLQEKFKANLATRFPPQRCQRIFDLCSHQASLEATPVNRFM 489
gi 47502792  394 NKRSIANAVQVHFKDGTVTENVECEYPLGHRFRRDEAIPKVVQKFTASMAGHYSSKQQEQIHEVCLNEEKLENMNVNEFV 473

                 ....*
1SZQ_A       479 DLYVI 483
gi 32261947  480 DLFAL 484
gi 2497946   479 DLYVI 483
gi 489193727 490 DLLAI 494
gi 47502792  474 DLFLI 478
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap