Conserved Protein Domain Family
HpaX

?
TIGR02332: HpaX 
4-hydroxyphenylacetate permease
This protein is a part of the Major Facilitator Superfamily (pfam07690). Member of this family are found in a number of proteobacterial genomes, but only in the context of having genes for 4-hydroxyphenylacetate (4-HPA) degradation. The protein is characterized by Prieto, et al. ( as 4-hydroxyphenylacetate permease in E. coli, where 3-HPA and 3,4-dihydroxyphenylacetate are shown to competitively inhibit 4-HPA transport and therefore also interact specificially.
Statistics
?
PSSM-Id: 131385
View PSSM: TIGR02332
Aligned: 2 rows
Threshold Bit Score: 746.425
Threshold Setting Gi: 30043853
Created: 8-Oct-2014
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 38112624  28 VIKKLFRRLIVFLFVLFIFSFLDRINIGFAGLTMGRDLGLSATMFGLATTLFYAAYVIFGIPSNIMLSIVGARRWIATIM 107
gi 30043853  20 VINKLFRRLIIFLFILFVFSFLDRINIGFAGLTMGKDLGLTSTMFGLAATLFYVTYVMCGIPSNMMLAKIGARRWIAGIM 99
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 38112624 108 VLWGIASTATMFATGPTSLYVLRILVGITEAGFLPGILLYLTFWFPAYFRARANALFMVAMPVTTALGSIVSGYILSLDG 187
gi 30043853 100 VVWGIASTCTMFATSPETLYLLRMLVGIAEAGFLPGILVYLTWWFPAYHRARANALFMIAMPVTMMLGLILSGYILALDG 179
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 38112624 188 VMALKGWQWLFLLEGFPSVLLGVMVWFWLDDSPDKAKWLTKEDKKCLQEMMDNDRltlVQpegAISHHAMQqRSMWREIF 267
gi 30043853 180 LWNLKGWQWLFLLEGLPSVILGVVTWFYLNDTPDQATWLDENEKQALKTMILREQ---ES---AFAHASVP-RSTLREVL 252
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 38112624 268 TPVVMMYTLAYFCLTNTLSAISIWTPQILQSFNQGSSNITIGLLAAVPQICTILGMVYWSRHSDRRQERRHHTALPYLFA 347
gi 30043853 253 TPAIMLYTLAYFCLTNTLSAINIWTPQILQSFNTGSSNIMIGLLAAIPQFCTIFGMIWWSRRSDRLKERKKHTILPYLFA 332
                       330       340       350       360       370       380       390       400
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 38112624 348 AAGWLLASATDHNMIQMLGIIMASTGSFSAMAIFWTTPDQSISLRARAIGIAVINATGNIGSALSPFMIGWLKDLTGSFN 427
gi 30043853 333 AAGWLLASATDHSLIQLSSIIMASMGSFTAMTIFWTTPDQVISLQSRAVAMAVINAVGNVGSAVSPLLIGILKDATGSFS 412
                       410
                ....*....|..
gi 38112624 428 SGLWFVAALLVI 439
gi 30043853 413 SGLWFVAGLLVL 424
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap