Conserved Protein Domain Family
2met_isocit_dHY

?
TIGR02333: 2met_isocit_dHY 
2-methylisocitrate dehydratase, Fe/S-dependent
Members of this family appear in an operon for the degradation of propionyl-CoA via 2-methylcitrate. This family is homologous to aconitases A and B and appears to act the part as 2-methylisocitrate dehydratase, the enzyme after PrpD and before PrpB. In Escherichia coli, which lacks a member of this family, 2-methylisocitrate dehydratase activity was traced to aconitase B (TIGR00117) ().
Statistics
?
PSSM-Id: 131386
View PSSM: TIGR02333
Aligned: 4 rows
Threshold Bit Score: 1834.23
Threshold Setting Gi: 15676345
Created: 8-Oct-2014
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 24983887    2 NTAYRKHLPGT----DLDYFDARAAVEAIKPGAYDGLPYTSRVLAENLVRR---CDPATLDASLSQLIERKRDLDFPWFP 74
gi 24345782    6 NTQYRKPLPGT----ALDYFDTREAIEAIAPGAYAKLPYTSRVLAENLVRR---CEPEMLTASLKQIIESKQELDFPWFP 78
gi 447010180   2 NSLYRKALSPSpaqsQVDFFDTRAAVEALKPGAYQTLPYTARILAENLVRR---CPPEQLSESLLQIIERKRDLDFPWYP 78
gi 488153723   4 NQRYRKPLPGT----DLEYYDARAACEDIKPGSYDKLPYTSRILAENLVNRadkVDLPTLQSWLGQLIEGKQEIDFPWYP 79
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 24983887   75 ARVVCHDILGQTALVDLAGLRDAIADKGGDPAQVNPVVPVQLIVDHSLAVECGGFDPQAFEKNRAIEDRRNEDRFHFINW 154
gi 24345782   79 ARVVCHDILGQTALVDLAGLRDAIAAKGGDPAQVNPVVPTQLIVDHSLAVEYGGFDKDAFAKNRAIEDRRNEDRFHFINW 158
gi 447010180  79 ARVVCHDILGQTALVDLAGLRDAIAEQGGDPAQVNPVVETQLIVDHSLAVEYSGCDPDAFEKNRAVEDRRNEDRFHFIEW 158
gi 488153723  80 ARVVCHDILGQTALVDLAGLRDAIAEKGGDPAKVNPVVQTQLIVDHSLAVECGGYDPDAFRKNREIEDRRNEDRFHFINW 159
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 24983887  155 TKKAFKNVDVIQPGNGIMHQINLEKMSPVVHSDRGVAYPDTCVGTDSHTPHVDALGVIAIGVGGLEAENVMLGRASWMRL 234
gi 24345782  159 TQKAFKNIDVIPQGNGIMHQINLERMSPVIHARNGVAFPDTLVGTDSHTPHVDALGVIAIGVGGLEAESVMLGRASYMRL 238
gi 447010180 159 CKTAFKNVSVIPAGNGIMHQINLEKMSPVIQVKEGVAFPDSCVGTDSHTPHVDALGVLAIGVGGLEAETVMLGRPSMMRL 238
gi 488153723 160 TKTAFENVDVIPAGNGIMHQINLEKMSPVVQVKNGVAFPDTCVGTDSHTPHVDSLGVISVGVGGLEAETVMLGRASMMRL 239
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 24983887  235 PEIVGVELTGKLAPNITATDLVLALTEFLRKQKVVGAYLEFHGEGARALTLGDRATISNMAPEYGATAAMFAIDQQTIDY 314
gi 24345782  239 PDIIGVELTGKPQPGITATDIVLALTEFLRAQKVVSSYLEFFGEGAEALTLGDRATISNMTPEFGATAAMFYIDQQTLDY 318
gi 447010180 239 PDIVGVKLTGARQPGITATDIVLALTEFLRRERVVSAYLEFFGEGAKALTIGDRATISNMTPEYGATAGMFYIDEQTIQY 318
gi 488153723 240 PDIVGVELNGKRQAGITATDIVLALTEFLRKERVVGAFVEFFGEGARSLSIGDRATISNMTPEFGATAAMFAIDEQTIDY 319
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 24983887  315 LRLTGREEQQVKLVETYAKATGLWADSLGGAVYERTLSFDLSSVVRNMAGPSNPHARVATSDLAAKGIAGSWEE----VP 390
gi 24345782  319 LTLTGREAEQVKLVETYAKTAGLWSDDLKQAVYPRTLHFDLSSVVRTIAGPSNPHARVPTSELAARGISGEVEN----EP 394
gi 447010180 319 LKLTGREPEQVALVESYAKAAGLWADSLEHAEYERVLEFDLSSVERNLAGPSNPHRRLPTKDLSARGIAIPAQQreaqQA 398
gi 488153723 320 LKLTGRDDAQVKLVETYAKTAGLWADALKTAVYPRVLKFDLSSVTRNMAGPSNPHARFATADLAAKGLAKPYEE----PS 395
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 24983887  391 -GQMPDGAVIIAAITSCTNTSNPRNVIAAGLIARNANKLGLTRKPWVKSSLAPGSKAVQLYLEEAGLEKELEQLGFGIVA 469
gi 24345782  395 -GLMPDGAVIIAAITSCTNTSNPRNVIAAGLLARNANAKGLTRKPWVKTSLAPGSKAVQLYLEEANLLPELESLGFGIVG 473
gi 447010180 399 eGLMPDGAVIIAAITSCTNTSNPRNVVAAGLLAKKANQLGLKRQPWVKTSFAPGSKVAKLYLQEAGLLSELEQLGFGIVA 478
gi 488153723 396 dGQMPDGSVIIAAITSCTNTSNPRNVVAAALLARNANRLGLKRKPWVKSSFAPGSKVAEIYLKEAGLLPEMEKLGFGIVA 475
                        490       500       510       520       530       540       550       560
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 24983887  470 FACTTCNGMSGALDPVIQQEIIDRDLYATAVLSGNRNFDGRIHPYAKQAFLASPPLVVAYAIAGTIRFDIEKDVLGV-VD 548
gi 24345782  474 FACTTCNGMSGALDPVIQQEVIDRDLYATAVLSGNRNFDGRIHPYAKQAFLASPPLVVAYAIAGTIRFDIEKDVLGLdKD 553
gi 447010180 479 YACTTCNGMSGALDPAIQQEIIERDLYATAVLSGNRNFDGRIHPYAKQAFLASPPLVVAYAIAGTMRFDIERDALGHdAQ 558
gi 488153723 476 FACTTCNGMSGALDPKIQKEIIDRDLYATAVLSGNRNFDGRIHPYAKQAFLASPPLVVAYALAGSIRFDIENDVLGV-AD 554
                        570       580       590       600       610       620       630       640
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 24983887  549 GKEIRLKDIWPSDEEIDAVVRAAVKPEQFRKVYIPMFAIEeDRGPKVAPLYDWRPMSTYIRRPPYWEGALAGERTLRGMR 628
gi 24345782  554 GKPVRLINIWPSDAEIDAVIAASVKPEQFRKVYEPMFDLSvDYGDKVSPLYDWRPQSTYIRRPPYWEGALAGERTLKGMR 633
gi 447010180 559 GKPIYLNHLWPSDEEIDAVVGRAVKPEQFKQIYIQMFKLD-ETQSASSPLYDWRPMSTYIRRPPYWEGALAAPRTLKAMR 637
gi 488153723 555 GKEIRLKDIWPADEEIDAVVAEYVKPQQFRDVYVPMFDTG-TAQKAPSPLYDWRPMSTYIRRPPYWEGALAGERTLRGMR 633
                        650       660       670       680       690       700       710       720
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 24983887  629 PLAVLPDNITTDHLSPSNAIMLDSAAGEYLAKMGLPEEDFNSYATHRGDHLTAQRATFANPKLFNEMVRN-DdGSVKQGS 707
gi 24345782  634 PLAVLGDNITTDHLSPSNAIMMDSAAGEYLHKMGLPEEDFNSYATHRGDHLTAQRATFANPKLKNEMAIV-D-GKVKQGS 711
gi 447010180 638 PLAILGDNITTDHLSPSNAILASSAAGEYLTKMGVPEEDFNSYATHRGDHLTAQRATFANPKLFNEMVKE-N-GQIKQGS 715
gi 488153723 634 PLAILPDNITTDHLSPSNAILAVSAAGEYLAKMGLPEEDFNSYATHRGDHLTAQRATFANPKLFNEMVKNeD-GSVRQGS 712
                        730       740       750       760       770       780       790       800
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 24983887  708 LARIEPEGKVTRMWEAIETYMQRKQPLIIVAGADYGQGSSRDWAAKGVRLAGVEAIVAEGFERIHRTNLVGMGVLPLEFK 787
gi 24345782  712 LARIEPEGIVTRMWEAIETYMDRKQPLIIIAGADYGQGSSRDWAAKGVRLAGVEAIVAEGFERIHRTNLVGMGVLPLEFK 791
gi 447010180 716 LARIEPEGKVTRMWEAIETYMNRKQPLIVIAGADYGQGSSRDWAAKGVRLAGVEAIVAEGFERIHRTNLVGMGVLPLEFK 795
gi 488153723 713 FARVEPEGETMRMWEAIETYMNRKQPLIIIAGADYGQGSSRDWAAKGVRLAGVEAIVAEGFERIHRTNLIGMGVLPLQFK 792
                        810       820       830       840       850       860       870
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|..
gi 24983887  788 PGTDRKTLGLDGSETYDVLGARTPRATLTLVVTRANGECLEVPVTCRLDTAEEVSIYEAGGVLQRFAQDFLE 859
gi 24345782  792 AGENRATYGIDGTEVFDVIGSIAPRADLTVIITRKNGERVEVPVTCRLDTAEEVSIYEAGGVLQRFAQDFLE 863
gi 447010180 796 PGVNRHSLALDGTELFDVVGEIRPGADLALVVTRQNGEKLDVAVTCRLDTADEVHVYQAGGVLQRFAQDFLA 867
gi 488153723 793 PDTNRHTLQLDGTETYDVVGERTPRCDLTLVIHRKNGETVEVPVTCCLDTAEEVLVYEAGGVLQRFAQDFLE 864
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap