2H9F


Conserved Protein Domain Family
prpF

?
TIGR02334: prpF 
Click on image for an interactive view with Cn3D
probable AcnD-accessory protein PrpF
The 2-methylcitrate cycle is one of at least five degradation pathways for propionate via propionyl-CoA. Degradation of propionate toward pyruvate consumes oxaloacetate and releases succinate. Oxidation of succinate back into oxaloacetate by the TCA cycle makes the 2-methylcitrate pathway a cycle. This family consists of PrpF, an incompletely characterized protein that appears to be an essential accessory protein for the Fe/S-dependent 2-methylisocitrate dehydratase AcnD (TIGR02333). This protein is related to but distinct from FldA (part of pfam04303), a putative fluorene degradation protein of Sphingomonas sp. LB126. [Energy metabolism, Fermentation]
Statistics
?
PSSM-Id: 131387
View PSSM: TIGR02334
Aligned: 6 rows
Threshold Bit Score: 730.482
Threshold Setting Gi: 114794281
Created: 8-Oct-2014
Updated: 23-Jan-2015
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2H9F_A         5 PPQIRIPATYLRGGTSKGVFFRLEDLPESCRVPGEARDRLFXRVIGSPDPYAAHIDGXGGATSSTSKCVILSKSSQPGHD 84
gi 28806636    9 MSQIKVPATYMRGGTSKGVFFNLEDLPSEAQVAGEARDKLLLRVIGSPDPYGKQIDGMGGATSSTSKTVIVSRSSRDDHD 88
gi 28056508    4 LPQCRIPATYLRGGTSKGVFFRLEDLPPACRVPGPARDALLLRVIGSPDPYGKQIDGMGGGTSSTSKVVIIAPSAYPNHD 83
gi 489205137   4 PPQIRIPATYLRGGTSKGVFFRLEDLPESCRVPGEARDRLFMRVIGSPDPYAAHIDGMGGATSSTSKCVILSKSSQPGHD 83
gi 488153724   1 MPQIKIPAVYYRGGTSKGVFFKRSDLPEAAREAGSARDKILLRVLGSPDPYGKQIDGLGNASSSTSKAVILDKSERADHD 80
gi 21107281    4 LPQLRIPATYMRGGTSKGVFFRLQDLPTAAQQPGAARDALLLRVIGSPDPYAKQIDGMGGATSSTSKSVIVSASTRDGHD 83
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2H9F_A        85 VDYLYGQVSIDKPFVDWSGNCGNLSTGAGAFALHAGLVDPARIPEDGICEVRIWQANIGKTIIAHVPVSGGQVQETGDFE 164
gi 28806636   89 VDYLFGQVSIDKPFVDWSGNCGNLSAAVGSFAIHAGLIPQERILENGIVTVRVWQVNISKTILVHVPIVNGFVQETGEFE 168
gi 28056508   84 VDYLFGQVAIEGACVDWTGNCGNLSAAVGPFAIAAGIVDPARVPHRGICSVRIWQANIGKTIVAHVPILDGQVQESGDFM 163
gi 489205137  84 VDYLYGQVSIDKPFVDWSGNCGNLSTGAGAFALHAGLVDPARIPEDGICEVRIWQANIGKTIIAHVPVSGGQVQETGDFE 163
gi 488153724  81 VDYLFGQVSIDKPFVDWSGNCGNLTAAVGAFSIEQGLVDKGKIPSDGICTVKIWQKNIGKTIIAHVPMQNGAVLETGDFE 160
gi 21107281   84 VDYLFGQVSIDSAFVDWSGNCGNLSAAVGPFAIASGLIDPARVPRDGVATVRIWQANIGKTIVAHVPMTGGLVQETGDFE 163
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2H9F_A       165 LDGVTFPAAEIVLEFLDPSDd--GEdgGAIFPTGNLVDDLEVPGVGTFKATXINAGIPTVFVNAEEIGYRGTELREEING 242
gi 28806636  169 LDGVTFPAAEIQVDFVDPAD---GE--GSMFPTGNLVDDLVVPDVGTFNATFINAGIPTIFIDAESIGYQGTELQDQINN 243
gi 28056508  164 MEGAAFPGAEVRLEFLNPADv-gGD--RVMFPTGHLIDTLDVPGLGPIEATLINAGIPMLCVDAHALGYTGTELQEAING 240
gi 489205137 164 LDGVTFPAAEIVLEFLDPSDd--GEdgGAIFPTGNLVDDLEVPGVGTFKATMINAGIPTVFVNAEEIGYRGTELREEING 241
gi 488153724 161 LDGVTFPAAEVQIEFLDPAD---GE--GSMFPTGNLVDEIDVPNIGRLKATLINAGIPTVFLNAADLGYTGKELQDDINN 235
gi 21107281  164 LDGVTFPAAEVQLEFLDPADdaeGDg-GAMFPTGNVIDQLEIPGLGTLDATLINAGIPTIFVNARDLGYTGTELQDAING 242
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2H9F_A       243 DPQQLARFERIRVAGALRXGLIKTPEEAATRQHTPKIAFVAPPRDYRTASGKLVAAGDIDLLVRALSXGKLHHAXXGTAA 322
gi 28806636  244 DDAALAMFESIRAHGALKMGLISDLEEAQTRQHTPKVAFVSKPKSYQSSSGKAVNESEIDVLVRALSMGKLHHAMMGTAA 323
gi 28056508  241 DPHALVCLETLRAYGALRMGVIGHLEDMVQHQHTPKLAFVAAPADYVASGGRHVHATEIDVLVRAMSMGRLHHAMMGTAA 320
gi 489205137 242 DPQQLARFERIRVAGALRMGLIKTPEEAATRQHTPKIAFVAPPRDYRTASGKLVAAGDIDLLVRALSMGKLHHAMMGTAA 321
gi 488153724 236 DAAALEKFEKIRAYGALKMGLISDVSEAAARAHTPKVAFVAPAADYTASSGKTVNAADIDLLVRALSMGKLHHAMMGTAS 315
gi 21107281  243 DPRALTMFETLRAHGAVRMGLIAKVEDAATRQHTPKVAFVAPPADYTASSRKPVHAAEIDLLVRAMSMGKLHHAMMGTAA 322
                        330       340       350       360       370       380       390
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....
2H9F_A       323 VAIGTAAAIPGTLVNLAAGGGERSAVRFGHPSGTLRVGAEASQANGEWTVTKAIXSRSARILXEGWVRVPGDAF 396
gi 28806636  324 VAIASAACVPGTLVNLAAGGGEKESVTFGHPSGTLKVGAQAKQTEQGWVVQKAIMSRSARILMEGFVRVPSDVF 397
gi 28056508  321 VALGTAAAIPGTLVNRAAGGGLRRVVRFGHPSGTLQVGAEVHQVNGQWSVANVRMSRSARVLMEGCVRVPAESV 394
gi 489205137 322 VAIGTAAAIPGTLVNLAAGGGERSAVRFGHPSGTLRVGAEASQANGEWTVTKAIMSRSARILMEGWVRVPGDAF 395
gi 488153724 316 VAIATAAAVPGTLVNLAAGGGTRKEVRFGHPSGTLRVGAAAECQDGQWTATKAVMSRSARVMMEGWVRVPEDCF 389
gi 21107281  323 VAIGTAAAVPGTLVNLAAGGAARSAVRFGHPSGTLRVGAQAQLVEGQWQVTKALMSRSARVLMEGWVRVPAPVA 396
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap