1EI6


Conserved Protein Domain Family
hydr_PhnA

?
TIGR02335: hydr_PhnA 
Click on image for an interactive view with Cn3D
phosphonoacetate hydrolase
This family consists of examples of phosphonoacetate hydrolase, an enzyme specific for the cleavage of the C-P bond in phosphonoacetate. Phosphonates are organic compounds with a direct C-P bond that is far less labile that the C-O-P bonds of phosphate attachment sites. Phosphonates may be degraded for phosphorus and energy by broad spectrum C-P lyase encoded by large operon or by specific enzymes for some of the more common phosphonates in nature. This family represents an enzyme from the latter category. It may be found encoded near genes for phosphonate transport and for pther specific phosphonatases.
Statistics
?
PSSM-Id: 131388
View PSSM: TIGR02335
Aligned: 4 rows
Threshold Bit Score: 723.227
Threshold Setting Gi: 39650655
Created: 8-Oct-2014
Updated: 23-Jan-2015
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1EI6_A        4 ISVNSRSYRLSSAPTIVICVDGCEQEYINQAIQAGQAPFLAELTGFGTVLTGDCVVPSFTNPNNLSIVTGAPPSVHGICG 83
gi 1196755    5 ISVNSRSYRLSSAPTIVICVDGCEQEYINQAIQAGQAPFLAELTGFGTVLTGDCVVPSFTNPNNLSIVTGAPPSVHGICG 84
gi 39650655   7 IEANGRSYAVPQRPVVVICLDGFDPEYLERGIADGVLPTIGALRSAGYVGTALATVPTTTNTNNTSIVTGVPPAIHGING 86
gi 33567596   5 IALHGRHYALPQRPTVVVCIDGCDPEYIARGIADGVCPAIARFFEEGFGAVADCVMPSFTNPNNVSVVTGAPPAVHGIGG 84
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1EI6_A       84 NFFFDQETQEEVLMNDAKYLRAPTILAEMAKAGQLVAVVTAKDKLRNLLGHQLKGICFSAEKADQVNLEEHGVENILARV 163
gi 1196755   85 NFFFDQETQEEVLMNDAKYLRAPTILAEMAKAGQLVAVVTAKDKLRNLLGHQLKGICFSAEKADQVNLEEHGVENILARV 164
gi 39650655  87 NYYLDADTGEEIMVTDARRLRCGTILGAMSKAGVRTAVVTAKDKLLKVLAYEMDGIAFSSEHPNVADLTALGFKSGEELV 166
gi 33567596  85 NYYLDRDTGREIMMTDAALLRGDTLLGLMSQAGVPTAAITAKDKLRKVLGHGLRGICFSSEKADQCSEAEHGVADVAALV 164
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1EI6_A      164 GMPVPSVYSADLSEFVFAAGLSLLTNERPDFMYLSTTDYVQHKHAPGTPEANAFYAMMDSYFKRYHEQGAIVAITADHGM 243
gi 1196755  165 GMPVPSVYSADLSEFVFAAGLSLLTNERPDFMYLSTTDYVQHKHAPGTPEANAFYAMMDSYFKRYHEQGAIVAITADHGM 244
gi 39650655 167 GRGRPDQYSADLSLFALDAGIRLMETAKPELIYLSTSDYVQHKYQPGEAESNDFHAAVDRRIARLIELGATVALTADHGM 246
gi 33567596 165 GRPRPDMYSGDLSLYVLDAGLALLRQGRARLLYLSLSDYIQHKHAPGEPESDAFLRAIDTRLQAFVDAGAVVACIADHGM 244
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1EI6_A      244 NAKTDAIGRPNILFLQDLLDAQYGAQRTRVLLPITDPYVVHHGALGSYATVYLRDAVPQRDAIDFLAGIAGVEAVLTRSQ 323
gi 1196755  245 NAKTDAIGRPNILFLQDLLDAQYGAQRTRVLLPITDPYVVHHGALGSYATVYLRDAVPQRDAIDFLAGIAGVEAVLTRSQ 324
gi 39650655 247 ADKSRADGQPNVVYLEDALNETFGAGVARVICPIADPFVRHHGALGGFVRAHLLKPCDIAAMMTFARSLPGVELVLDRAT 326
gi 33567596 245 SHKTDAQGRPNAIFLQDLLEARFGAGSARIICPITDPFVRHHGALGSFVRGYARNPADIEAMMQAAAAIDGVQEVLSREQ 324
                       330       340       350       360       370       380       390       400
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1EI6_A      324 ACQRFELPEDRIGDLVVLGERLTVLGSAADKHDLSGL-TVPLRSHGGVSEQKVPLIFNRKLV----GLDSPGRLRNFDII 398
gi 1196755  325 ACQRFELPEDRIGDLVVLGERLTVLGSAADKHDLSGL-TVPLRSHGGVSEQKVPLIFNRKLV----GLDSPGRLRNFDII 399
gi 39650655 327 VCERYQLPPDREGDFAVFTDRGTAVGARREDHDLSALgDHRLRSHGGLGEQRVPFVLSRPLKrdyrERAATGVLRNYDIF 406
gi 33567596 325 AAQRLGLPLDREADFVVISHESYVLGSRADEHDLSTVgDHPLRSHGGYSEQPVPFFLSQPLSpayrERAAQGGLRNFDIF 404

                ....*...
1EI6_A      399 DLALNHLA 406
gi 1196755  400 DLALNHLA 407
gi 39650655 407 DFALNGVD 414
gi 33567596 405 DFALNGVQ 412
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap