2ZDI


Conserved Protein Domain Family
gimC_beta

?
TIGR02338: gimC_beta 
Click on image for an interactive view with Cn3D
prefoldin, beta subunit, archaeal
Chaperonins are cytosolic, ATP-dependent molecular chaperones, with a conserved toroidal architecture, that assist in the folding of nascent and/or denatured polypeptide chains. The group I chaperonin system consists of GroEL and GroES, and is found (usually) in bacteria and organelles of bacterial origin. The group II chaperonin system, called the thermosome in Archaea and TRiC or CCT in the Eukaryota, is structurally similar but only distantly related. Prefoldin, also called GimC, is a complex in Archaea and Eukaryota, that works with group II chaperonins. Members of this protein family are the archaeal clade of the beta class of prefoldin subunit. Closely related, but outside the scope of this family are the eukaryotic beta-class prefoldin subunits, Gim-1,3,4 and 6. The alpha class prefoldin subunits are more distantly related.
Statistics
?
PSSM-Id: 131391
View PSSM: TIGR02338
Aligned: 10 rows
Threshold Bit Score: 81.6273
Threshold Setting Gi: 22256954
Created: 8-Oct-2014
Updated: 23-Jan-2015
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2ZDI_A        4 IPPQVQAMLGQLDTYQQQLQLVIQQKQKVQADLNEAKKALEEIETLPDDAQIYKTVGTLIVKTT-KEKAVQELKEKIETL 82
gi 6136571    3 LPQNVQHQLAQFQQLQQQAQAISVQKQTVEMQINETQKALEELSRAADDAEVYKSSGNILIRVA-KDELTEELQEKLETL 81
gi 22256954   1 MAQNVEQQVAQLQQLQQQLSSIVAQKQQLELQLREIERALKELDEIEEDTKVYKTVGGLLIEAD-RDEVKEELEDRKETL 79
gi 23821955   5 LPPQIQNQIAQLQQVQQQVQALSMQKSQIEAMQKESKMALEELERLADDAVIYRSVGELVIKTT-KEESVSKLKDREETL 83
gi 22256955   4 IPPQVQAMLGQLESYQQQLQLVIQQKQKVQADLNEAKKALEEIEKLTDDAVIYKTVGTLIVKTT-KEKALQELKEKVETL 82
gi 6136598    4 LPPQVQNLVAQLQQLQQQLQAVITQRAQVEALLRDTEQALEELQKVDDETPVYKAVGNILVKEK-KEDVIKELTEKKETY 82
gi 12230449   5 LPPEAQEKLEQLQDLQEKAQNVATQKQQAEQQLSEAETALDALGDIEESTTMYREVGELLVETE-YDNAHDDLDEKVSDL 83
gi 22256959   5 IPPELQTQLVKLQQLQDQLNRLLTEKNVIDSELREVNKILQELSQLPAGTTVYKIVGNLLVKTD-KETVQKELDDRKEIL 83
gi 22256958   4 IPPSLQDLVNRFNQAQAQLQNVLLRKQQYEAELKEVEKAISEIERLPQDAKIFKNVGNFLVPQS-RDVALQELRDRKELL 82
gi 22256960   6 ISSYLQNQLKQAQELEENIEKIATQRYQLDLSLKEIEKTLQELNKIDDKTPVYRSIGSILYKVDdKKKLIDELEEQLELT 85
                        90       100       110
                ....*....|....*....|....*....|.
2ZDI_A       83 EVRLNALNRQEQKINEKVKELTQKIQAALRP 113
gi 6136571   82 QLREKTIERQEERVMKKLQEMQVNIQEAMKG 112
gi 22256954  80 ELRVKTLEKQEKRLQQQIENLQKRLQKALQQ 110
gi 23821955  84 SLRLQSISRQEERLTARFKQLQEQIQQALGP 114
gi 22256955  83 EVRLNALNRQEQKINEKIKELTQKIQAALRP 113
gi 6136598   83 EIRIKTLQRQEEKLRERFAETQQKLQNLLSP 113
gi 12230449  84 EVRVETLQKQEDRVQEQFESLQEELQDMLGG 114
gi 22256959  84 ELRSRTYQKQENLLRTQLEDLQKKVNELLAK 114
gi 22256958  83 ELHVKTLTRQESMLREQLDKLREEINKELAK 113
gi 22256960  86 KIRINTLDKQQKSLEEKYKELQAAIRERYNQ 116
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap