1JWB


Conserved Protein Domain Family
moeB

?
TIGR02355: moeB 
Click on image for an interactive view with Cn3D
molybdopterin synthase sulfurylase MoeB
This model describes the molybdopterin biosynthesis protein MoeB in E. coli and related species. The enzyme covalently modifies the molybdopterin synthase MoaD by sulfurylation. This enzyme is closely related to ThiF, a thiamine biosynthesis enzyme that modifies ThiS by an analogous adenylation. Both MoeB and ThiF belong to the HesA/MoeB/ThiF family (pfam00899). [Biosynthesis of cofactors, prosthetic groups, and carriers, Molybdopterin]
Statistics
?
PSSM-Id: 131408
View PSSM: TIGR02355
Aligned: 6 rows
Threshold Bit Score: 426.533
Threshold Setting Gi: 24345520
Created: 8-Oct-2014
Updated: 23-Jan-2015
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1JWB_B        8 EMLRYNRQIILRGFDFDGQEALKDSRVLIVGLGGLGCAASQYLASAGVGNLTLLDFDTVSLSNLQRQTLHSDATVGQPKV 87
gi 33149002   7 EMLRYNRQIILQNVDFDGQEKLKASRVLIVGLGGLGCAAAQYLAAAGIGRLILVDFDEVSRSNLQRQILHSEANIGMPKV 86
gi 1170993    8 EELRYNRQIILKSVDFDGQEKLKASKMLIVGLGGLGCAASQYLAAAGVGNLTLLDFDTVSLSNLQRQVLHCDARLNMPKV 87
gi 127233     8 EMLRYNRQIILRGFDFDGQEALKDSRVLIVGLGGLGCAASQYLASAGVGNLTLLDFDTVSLSNLQRQTLHSDATVGQPKV 87
gi 24345520  12 ELTRYSRQISIKAMDIDGQERLKLAKVLMIGAGGLGCAAGQYLTVAGIGELTLVDFDTVELSNLQRQVLHQDANIGQPKV 91
gi 28809539   8 EMLRYNRQIILRQFDFEGQEALKQSSVLILGAGGLGCASSQYLATAGVGRITLIDDDIVELSNLQRQVLHHDTDIGRKKV 87
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1JWB_B       88 ESARDALTRINPHIAITPVNALLDDAELAALIAEHDLVLDCTDNVAVRNQLNAGCFAAKVPLVSGAAIRMEGQITVFTYQ 167
gi 33149002  87 QSAKARLSEINPYIQIDAINQKCSSEQWASLIAKVDVVVDCTDNVEVRNQLNVQCFAQKRPLVSGSAIRFEGQISVFTYQ 166
gi 1170993   88 ESAKIALEQINPHINIETINAKLDEEKLAEIIPHFDIVLDCTDNVEIRNQLDRQCNHMKVPLISGAAIRMEGQVSVFTYE 167
gi 127233    88 ESARDALTRINPHIAITPVNALLDDAELAALIAEHDLVLDCTDNVAVRNQLNAGCFAAKVPLVSGAAIRMEGQITVFTYQ 167
gi 24345520  92 ESAKQSLNQLNPHVKINPINAVLDDHEIDALVASHSIVVDCTDNVSVREQLNQSCFKHKVPLVSAAAIRMEGMVTVFDYQ 171
gi 28809539  88 DSAADALRELNPHVEVNTVAKRLDDAQLQALIEQHTVVVDASDNVDTRNQLNRLCFATKTPLISGAAIRMEGQVSVFTYD 167
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1JWB_B      168 D-GEPCYRCLSRLFGENALTCVEAGVMAPLIGVIGSLQAMEAIKMLAGYGKPASGKIVMYDAMTCQFREMKLMRNPGCEV 246
gi 33149002 167 A-DEPCYSCLSQLFGSGTLSCVEAGVIAPIVGVIGSLQALETIKLLLMIGTHLTGKLLIMDGLHFSIREMALPKLTTCPI 245
gi 1170993  168 P-NTPTYRDLSKLFRQNVLSCVEAGVLAPIVGIVGCIQALEAIKVRLKIGKNLCGRLLMIDGFSMNIREIKLPTNME--- 243
gi 127233   168 D-GEPCYRCLSRLFGENALTCVEAGVMAPLIGVIGSLQAMEAIKMLAGYGKPASGKIVMYDAMTCQFREMKLMRNPGCEV 246
gi 24345520 172 A-QTPCYHCFSSLFGEQQLSCVESGILAPVVGMVGCLQAVEAIKVITGIGKTLAGRILMIDAMTMEFREMKLPKQAHCKI 250
gi 28809539 168 DpTQPCYQCLSALFGSGALSCVEAGVMAPVVGIVGAVQAMETIKVIANYGQPKKGKILILDALSMSWREMNLIKMPTCPV 247

                .
1JWB_B      247 C 247
gi 33149002 246 C 246
gi 1170993      -
gi 127233   247 C 247
gi 24345520 251 C 251
gi 28809539 248 C 248
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap