Conserved Protein Domain Family
thiW

?
TIGR02359: thiW 
energy coupling factor transporter S component ThiW
Levels of thiamine pyrophosphate (TPP) or thiamine regulate transcription or translation of a number of thiamine biosynthesis, salvage, or transport genes in a wide range of prokaryotes. The mechanism involves direct binding, with no protein involved,to a structural element called THI found in the untranslated upstream region of thiamine metabolism gene operons. This element is called a riboswitch and is seen also for other metabolites such as FMN and glycine. This protein family consists of proteins identified in operons controlled by the THI riboswitch and designated ThiW. The hydrophobic nature of this protein and reconstructed metabolic background suggests that this protein acts in transport of a thiazole precursor of thiamine. [Transport and binding proteins, Other, Biosynthesis of cofactors, prosthetic groups, and carriers, Thiamine]
Statistics
?
PSSM-Id: 131412
View PSSM: TIGR02359
Aligned: 6 rows
Threshold Bit Score: 148.702
Threshold Setting Gi: 18160942
Created: 8-Oct-2014
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 20516745    4 IHRMVFMALIIAIGTLTSqYVWFSVGVAKVTPVQHAINVISAVFLGPWGALEVAFIIGLLRNILGVGSLLAFPGGMVGAF 83
gi 22776155    4 TRVLTLMAVLVAIGTIGSqLLWFPAGVARAYPVQHAVNVMAAVLLGPGPAVGVALMIGLLRNLLGLGTLLAFPGGMIGAF 83
gi 29344717    6 IHRVTLLALMIAMDVVLSpLMRIEG----MAPMSSVMNIIAGVLLGPLYGTLMALVCGLIRMTFLGIPPLALTGAVFGAF 81
gi 27315436    3 IRKLTITAFLIAINVVLSsLIVIPLGPIKAAPVQHFVNVLCAVFVGPWYGLAQAFISSVLRISFGTGSAFAFPGSMIGVL 82
gi 18160942    3 YRVVAYLAVFTGLGLALA-PLSFPVGPTRAFPGQHFVNGVAGVVIGP-WALAVAFLISLIRNMLGLGTVFAFPGSIPGAL 80
gi 499168712   9 ERKLALAAILGGLAVALS-VIRIDVGPTKALPWQHMVNVVAGVTLGPWWASGLALAVGLVRMALGIGTVYSIPGGIPGAL 87
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 20516745   84 IAGY----LYRFTRKFYFASIGEVIGTGIIGALLSYPIAKYILGSSG----AAFMFVIPFSLSSTIGSVIG-YVVVLVLA 154
gi 22776155   84 FAGI----LYRKWRRHRLAVTGEILGTGIVGSLLAVPFANFLMGSSV----GALAFLPAFIVSSVSGACIGwFILSRVHH 155
gi 29344717   82 FAGL----FYQWGQKLGWSMLGEIFGTGIIGSLLSYPVMVWFTGSKQn--fYWFIYTPRFIGATLIGSVIAwLVLVKLKE 155
gi 27315436   83 LSSL----FYMYRKHIFMASVGEVLGTGVIGSLMCIPLA-WFLGLQDf---FIKPLMLMFIVSSFIGALISyILLIILKR 154
gi 18160942   81 VVWLaataLRRFGKAHYAP-LFEPLGTLGLGFPAAAYVVAPLLGVGErfitGLIPIFIGWAASTITGSIAAfFVAVALRR 159
gi 499168712  88 LVGLgavaLLRLGRSPLPAGLLEPLGTAVIGFLLALYVFAPLMGDVEawrsALTVIWLGWLSSTLIGTTLGlAALVALER 167

                 ....*.
gi 20516745  155 KYKKFI 160
gi 22776155  156 TELSHI 161
gi 29344717  156 TRVFKQ 161
gi 27315436  155 RGLLDR 160
gi 18160942  160 LG--RL 163
gi 499168712 168 SGVVRL 173
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap