3B48


Conserved Protein Domain Family
dha_pts

?
TIGR02364: dha_pts 
Click on image for an interactive view with Cn3D
dihydroxyacetone kinase, phosphotransfer subunit
In E. coli and many other bacteria, unlike the yeasts and a few bacteria such as Citrobacter freundii, the dihydroxyacetone kinase (also called glycerone kinase) transfers a phosphate from a phosphoprotein rather than from ATP and contains multiple subunits. This protein, which resembles proteins of PTS transport systems, is found with its gene adjacent to
Statistics
?
PSSM-Id: 131417
View PSSM: TIGR02364
Aligned: 13 rows
Threshold Bit Score: 122.436
Threshold Setting Gi: 38201135
Created: 8-Oct-2014
Updated: 11-Oct-2014
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
3B48_A         6 ADILLVSHSKXITDGIKEXIEQXNAsEEITIHSLGGT--SDGSLGSDPXKIIDTINEaDS-DREFLIFADLGSAVLSSEL 82
gi 20517011    7 VGIVLVSHSRKIVEGVFELVNQMTR-GKVPIGIAGGT--PDGRLGTDAAEIVEQVKKvDR-GEGVVVLVDIGSAVMSAQT 82
gi 269849692   2 VNLVIVSHSSRLGEGVGELARQMLMsDSCKIAIAAGIddPQNPIGTDAVKVMEAIESvAD-ADHVLVMMDMGSALLSAET 80
gi 38201135    4 VGLVLVSHSQKLAEGLADLAAQMAG--DVHIVSAGGL--DDGGIGTSYDRIEAAVTEvRNgGEGVVILTDLGSATMTVEM 79
gi 27351833    5 VGIVIVSHSKDIAKGTADMVRQMVG-SEVKVAFCGGN--PDGGLGTSVSLIIDAINDaWS-AKGVAILVDLGGAETNSEM 80
gi 22778158    4 VGIVLISHSVKIAEGTKELVQQVMK--DVTVEVAGGT--DEGEIGTSIDKILNAITKa-NkDDGVLLLYDIGSAKMNAEM 78
gi 29343388    3 ADILLVSHSKMITDGIKEMIEQMNAsEEITIHSLGGT--SDGSLGSDPMKIIDTINEaDS-DREFLIFADLGSAVLSSEL 79
gi 26453796    2 VGIIVVSHSFLLGQEIIKLCNEMKK-NNFEIINCSGL--DKNTFGSDPIKIKEAIENnIKgNEGVFVFCDLGSSILNSQL 78
gi 447046912   2 PKIILVSHSKEIASGTKSLLKQMAG--DVDIIPIGGL--PDGSIGTSFDIIQEVLT---KlEDDALCFYDIGSSEMNVDM 74
gi 489819391   2 ISIVLVSHSQKITEGLQEMIVEMVG-DTVHIISSGGT--GDGRLGTNAIMIADNIATcTN-SEHIYIFCDIGSAILSAET 77
gi 19713082    4 VGFVVVSHSKELAEAAIHLANEMKR-YDFPLINGSGT--DGNFLGSNPLIIKEAILK-AKtDKGALIFVDIGSSVLNTQV 79
gi 499201996   6 FGIVISSHVPALAEGIVTLLKEAAK--DVSITYAGGT--DDDQVGASFEKIQQAVMD--NeADELFVFYDLGSAKMNVEM 79
gi 497616254   5 YGVVIISHSKDVAKGVHDIIKEIAP--DVSITHAGGT--EDGRIGTSFDAVNEAIEN--NeANKVYTFYDLGSAKMNIET 78
                         90       100       110       120       130
                 ....*....|....*....|....*....|....*....|....*....|
3B48_A        83 AFDXLEEDQQK--HYHLVDAPLVEGAFASAITAGVSDDLTQILAEAQNAG 130
gi 20517011   83 AVELLGEEYEG--KVKIADAPLVEGAVAAAVEASIGSDFEKVLTVAEEAK 130
gi 269849692  81 ALELLAPEIAA--KVRLCAAPLVEGTLAATVSAASGADIDKVIFDAMHAL 128
gi 38201135   80 VVDMADDPD-----VVFVDAPFVEAAIAAAVAAQQGGSTADVAAAARGAI 124
gi 27351833   81 AVEMLEPARRD--LVVVCNAPIVEGAVMAATEAAGGSSLAQVKAVAEELS 128
gi 22778158   79 AVEMTEVDD-----VELIEAPLVEGAYVAAVESGMGKEKHEIIEAVTQSF 123
gi 29343388   80 AFDMLEEDQQK--HYHLVDAPLVEGAFASAITAGVSDDLTQILAEAQNAG 127
gi 26453796   79 AIDLIEDESIDksKIIIADAPIVEGTLVASTLN-FDGNFNQIIDELKQLK 127
gi 447046912  75 AIEMYDGNHR----VLKVDAPIVEGSFIAAVKLSIGGSIDDALAEIKQSF 120
gi 489819391  78 ALELLDTDLLE--KTTIIDAPLVEGAFTAAVQSLVNPSKEAILQELTNVH 125
gi 19713082   80 AIDFLADEDVDieNIKIADVPLVEGLIAGVAVNDEKADIESVLEELNELK 129
gi 499201996  80 VMELSEKT------IHLMDVALVEGAYTAAALTQGGASF-ETIMEQLQPL 122
gi 497616254  79 VEEISEKE------IILFNAPILEGAYATAAQVQMD-EKPEVIAANLKTI 121
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap