Conserved Protein Domain Family
dimeth_PyL

?
TIGR02368: dimeth_PyL 
dimethylamine:corrinoid methyltransferase
This family consists of dimethylamine methyltransferases from the genus Methanosarcina. It is found in three nearly identical copies in each of M. acetivorans, M. barkeri, and M. Mazei. It is one of a suite of three non-homologous enzymes with a critical UAG-encoded pyrrolysine residue in these species (along with trimethylamine methyltransferase and monomethylamine methyltransferase). It demethylates dimethylamine, leaving monomethylamine, and methylates the prosthetic group of the small corrinoid protein MtbC. The methyl group is then transferred by methylcorrinoid:coenzyme M methyltransferase to coenzyme M. Note that the pyrrolysine residue is variously translated as K or X, or as a stop codon that truncates the sequence.
Statistics
?
PSSM-Id: 131421
View PSSM: TIGR02368
Aligned: 3 rows
Threshold Bit Score: 944.834
Threshold Setting Gi: 190359065
Created: 8-Oct-2014
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 190359064   1 MATEYALRMGDGKRVFLTKEKILEELEAGMANASDLGEIPDLSADEIDKLAEILMMPGKAVSVEQGMEVPVTHDIGTIRL 80
gi 182676431   1 MATEYALRMGDGKRVFLAREKIMEEIEAGTANAADLGEIPALSADEMNKLAEILMMPGKAVSVEHGMEIPVTHDIGTIRL 80
gi 190359065   1 MATEYALRMGDGKRIYLTKEKILSEIEAGSSNAADLGDIPDLSTDEMKKLAEILMMPGKAVSVEQGMEVPVTHDIGTIRL 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 190359064  81 DGDQGNSGVGIPSSRLVGCMTHERAFGADTMELGHIDYSFKPVKPVVSNECQAMEVCQQNMIIPLFYGAMPNMGLYYTPD 160
gi 182676431  81 DGDQGNSGVGIPSSRLVGCMMHERAFGADTMELGHIDYSFKPVKPVVANECQAMEVCQQNMIIPLFYGAMPNMGLYYTPD 160
gi 190359065  81 DGDQGNSGVGIPSSRLVGCMTHERAFGADTMELGHIDYSFKPVKPVVSNECQAMEVCQQNMIIPLFYGAMPNMGLYYTPD 160
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 190359064 161 GPFENPGDLMKAFKIQEAWESMEHAAEHLTRDTVWVMQKLFASGTDGVNFDTTAAAGDADMYGTLHAIEALRKEFPDMYI 240
gi 182676431 161 GPFENPGDLMKAFKIQEAWDSMEHAAEHLTRDTIWIMQKLFASGADGVNFDTTAAAGDGDFYGTLHAIEALRKEFPEMYI 240
gi 190359065 161 GPFENPGDLMKMFKIDKARESMEHAADHLTRDTVWVMQKLFASGADGVNFDTTAAAGDADMYGTLRAVEVLRAQFPEMYI 240
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 190359064 241 EAGMAGECVLGMHGNLQYDGVTLAGLWPHQQAPLVAKAGANVFGPVCNTNTSKTSAWNLARAVNFMKAAVQASPIPCHVD 320
gi 182676431 241 EAGMAGEMVLGMHGNLQYDGVTLAGLWPHQQAPLVAKAGANVFGPVVNTNTSKTSPWNLARAVTFIKEAVKVSSLPCHVD 320
gi 190359065 241 EVGMAGEMVLGMHGELEYDEVRLAGLWPHEQAPLIAKAGANVFGPVVNTNTSKTSAWNLARAVTFIKEAVKASPIPCHVN 320
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 190359064 321 MGMGVGGIPMLETPPVDAVTRASKAMVEVAGVDGIOIGVGDPLGMPISHIMASGMTGIRAAGDLVARMQFSKNMRIGEAK 400
gi 182676431 321 MGMGVGGIPMLETPPIDAVTRASKAMVEIAGVDGIOIGVGDPLGMPISHIMASGMTGMRAAGDLVARMQFSKNMKIKEAK 400
gi 190359065 321 MGMGVGGIPMLETPPVDAVTRASKAMVEVAGVDGIOIGVGDPLGMPISHIMASGMTGIRAAGDLVARMEFSKNMRIGEAK 400
                        410       420       430       440       450       460
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*.
gi 190359064 401 EYVAKKLNVDVMDLADEHVMRELREELDIGVITSVPGAAKGIAAKMNIEKLLDIKINSCNLFRKQI 466
gi 182676431 401 EYVAKKLNVEIRDLADEYIMRELREELNIGVITSVPGSAKGIAAKMNIEKLLGIKINSCELFRKQT 466
gi 190359065 401 EYVAKKLNVDTMDLADEHVMRELREELDIGVITSVPGAAKGIAAKMNIEKLLGIKINSCETFRAQL 466
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap