Conserved Protein Domain Family
pyl_corrinoid

?
TIGR02370: pyl_corrinoid 
methyltransferase cognate corrinoid proteins, Methanosarcina family
This model describes a subfamily of the B12 binding domain (pfam02607, pfam02310) proteins. Members of the seed alignment include corrinoid proteins specific to four different, mutally non-homologous enzymes of the genus Methanosarcina. Three of the four cognate enzymes (trimethylamine, dimethylamine, and monomethylamine methyltransferases) all have the unusual, ribosomally incorporated amino acid pyrrolysine at the active site. All act in systems in which a methyl group is transferred to the corrinoid protein to create methylcobalamin, from which the methyl group is later transferred elsewhere.
Statistics
?
PSSM-Id: 131423
View PSSM: TIGR02370
Aligned: 4 rows
Threshold Bit Score: 276.681
Threshold Setting Gi: 21542130
Created: 8-Oct-2014
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 21542130   9 KLTNAIATQNVAGCAQLAQEALDAGISPLDIITKGLSPGMKIIGDKFEAAEVFLPQIMMSAKAMEAAMKVLTPELEKTkV 88
gi 22001820  10 KAKEAITDFDDELAEEVANEALAAGIDPVELIEKGFTAGMEEVGEKFGQGELFLPHVLAAAEAMNSGIKVITPEMEKRkS 89
gi 22001751  10 ELSDAIVSCKKDRVIAAVEKAKEV-MEPAEIIEKGLAAGMNQVGTLFERGKLFLPHVMMAADSMTAGVNILEAEMPAG-T 87
gi 12751299  44 PVAKAIFEGEEDDVVEGLQKAIDSGKDPIALINDSLMVGMGVVSKLYDDGVIFLPNVMMSADAMLEGIDFLKQKAGKA-- 121
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 21542130  89 EgEEGTGLAITFVAEGDIHDIGHRLVTTMLGANGFDILDLGTDVLNETVVEEAAKHKGEkvLLVGSALMTTSMLGQKDLM 168
gi 22001820  90 Q-TKSLGTVAIGTIEGDIHSIGKDIVASMLNIAGFKVVDLGRDVPINTFVEKVKELKPQ--VVASSALMTTTMVNQIQIE 166
gi 22001751  88 E-TKKLGVIVNGTVEGDVHDIGKSIVSTMLQSAGFEVHDIGRDVPIKNFVEKAKEVNAD--MIGLSALMTTTMQGQRDVI 164
gi 12751299 122 --PEVKGKVVCHVAEGDVHDIGKNIVVALLRANGYDVIDLGRDVPVDEVIETVEKESPL--MLTGTALMTTTMYAFKEIN 197
                       170       180       190       200
                ....*....|....*....|....*....|....*....|.
gi 21542130 169 DRLREENLRDSVKCMFGGAPVSSKWIDEIGADATAENAAEA 209
gi 22001820 167 EQLKEAGVRDQVKTMVGGAPVTQDWADKIGADIYGESANDA 207
gi 22001751 165 ELLKEEGMRERVKVMVGGAPATQAWADKIGADCYAENASEA 205
gi 12751299 198 DKLMEKGYR--IPFACGGGAVNQDFVSQYELGVYGEEASDA 236
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap