1OMO


Conserved Protein Domain Family
ala_DH_arch

?
TIGR02371: ala_DH_arch 
Click on image for an interactive view with Cn3D
alanine dehydrogenase, Archaeoglobus fulgidus type
This enzyme, a homolog of bacterial ornithine cyclodeaminases and marsupial mu-crystallins, is a homodimeric, NAD-dependent alanine dehydrogenase found in Archaeoglobus fulgidus and several other Archaea. For a number of close homologs, scoring between trusted and noise cutoffs, it is not clear at present what is the enzymatic activity.
Statistics
?
PSSM-Id: 131424
View PSSM: TIGR02371
Aligned: 3 rows
Threshold Bit Score: 577.638
Threshold Setting Gi: 50513267
Created: 8-Oct-2014
Updated: 23-Jan-2015
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1OMO_A        2 ETLILTQEEVESLISMDEAMNAVEEAFRLYALGKAQMPPKVYLEFE--KGDLRAMPAHLMG--YAGLKWVNSHPGNPDKG 77
gi 2622612   12 KTVVLTRSDVEGLLNMDDCLKAVEGAFVQEALGRVQMPPKMYLFFRryNGDLRVMPSYLEEleMAGVKCVNVHPSNPDRH 91
gi 19917283   2 EVLWLAQEEVKSVVDMHSDMQVVESAFRQHGLGKVQMPPKSYLYYTvyNGDLRTMPAYLEEedITGVKIVNVHPGNPMRN 81
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1OMO_A       78 -LPTVMALMILNSPETGFPLAVMDATYTTSLRTGAAGGIAAKYLARKNSSVFGFIGCGTQAYFQLEALRRVFDIGEVKAY 156
gi 2622612   92 sLPTVMAVIELVDPETGFPIALMDGTHITDMRTGAAGGVSVKYLASRDASRLGIIGAGRQAWTQLMAISRVADLEEVSVY 171
gi 19917283  82 -LPTVMALIILISPETGAPVAIMDGTYLTDIRTGAAGGVAAKYLARKDSKVIGLVGAGNQARTQLEALCEVFEPETVRIT 160
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1OMO_A      157 DVREKAAKKFVSYCE-DRG--ISASVQPAEEASRCDVLVTTTPSRKPVVKAEWVEEGTHINAIGADGPGKQELDVEILKK 233
gi 2622612  172 CRTPSTREKFALRASkEYEvpVRAATDPREAVEGMDIVVTVTPSRSPVVMADWVSPGTHICAMGADAPGKQELDPLILKN 251
gi 19917283 161 SRTKESCDQFIKEMS-DFVpcEILYEESVEKVCDCDILVTTTPTRKPIVKASWVKEGTHINAIGADAVGKEELDPELLLR 239
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1OMO_A      234 AKIVVDDLEQAKHGGEINVAVSKGVIGVEDVHATIGEVIAGLKDGRESDEEITIFDSTGLAIQDVAVAKVVYENALSKNV 313
gi 2622612  252 ARVFYDSLEQATHSGEINVPITEGILRVDDLQGSLGDVMTGKIEGRTSPADVTVFDSTGLSIQDITTAWMIYERAVAGEV 331
gi 19917283 240 SKIIVDDMVQALHSGEVNVPLSKHYISENDIHAQLGEVIVGLKPGRTSEEEITIFDSTGLAIQDVATAHMVYERAVREGL 319

                ....*..
1OMO_A      314 GSKIKFF 320
gi 2622612  332 GLEVDLQ 338
gi 19917283 320 GRQVRMF 326
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap