1NIB,2DWT,1KBW,1NDR


Conserved Protein Domain Family
Cu_nitrite_red

?
TIGR02376: Cu_nitrite_red 
Click on image for an interactive view with Cn3D
nitrite reductase, copper-containing
This family consists of copper-type nitrite reductase. It reduces nitrite to nitric oxide, the first step in denitrification. [Central intermediary metabolism, Nitrogen metabolism]
Statistics
?
PSSM-Id: 131429
View PSSM: TIGR02376
Aligned: 11 rows
Threshold Bit Score: 472.73
Threshold Setting Gi: 17942998
Created: 8-Oct-2014
Updated: 23-Jan-2015
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1NIB_A        12 LPRVKVDLVKPPFVHAHDQVAKTGPRVVEFTMTIEEKKLVIDrE-GTEIHAMTFNGSVPGPLMVVHENDYVELRLINPDT 90
gi 2827765    50 LPRVKVDLVKPPFVHAHDQVAKTGPRVVEFTMTIEEKKLVIDrE-GTEIHAMTFNGSVPGPLMVVHENDYVELRLINPDT 128
gi 730153     30 LQRVKVDLVAPPLVHPHEQVVSGPPKVVQFRMSIEEKKMVIDdQ-GTTLQAMTFNGSMPGPTLVVHEGDYIELTLVNPAT 108
gi 160358923  44 LPRVKHTLVPPPFAHAHEQVAASGPVINEFEMRIIEKEVQLD-E-DAYLQAMTFDGSIPGPLMIVHEGDYVELTLINPPE 121
gi 30089160   45 GSADLVDQVAADPTDIPGPIDRSEPAEVDVTLRPEEVTAEVE-D-GVTFTYTTYNGQVPGPLVRVRQGDTVNLTFENPEE 122
gi 8249446    51 AQQTDVDRIAADPTAIPDPIDRSEPKTVSVEMTTKEQVAEIE-P-GVTYTYMTFGDQIPGPMIRVRRGDTVELTITNEEG 128
gi 543809     52 GELPVIDAVTTHAPEVPPAIDRDYPAKVRVKMETVEKTMKMD-D-GVEYRYWTFDGDVPGRMIRVREGDTVEVEFSNNPS 129
gi 2842630    49 LPRRKLDLVKPPFVHVHTQKAEGGPKVVEVTLTIEEKKLVIDgK-GTEVNAMTFDGSVPGPLIVVHQDDYVEVTLVNPET 127
2DWT_A         1 LPRVKHTLVPPPFAHAHEQVAASGPVINEFEMRIIEKEVQLD-E-DAYLQAMTFDGSIPGPLMIVHEGDYVELTLINPPE 78
1KBW_A        12 GELPVIDAVTTHAPEVPPAIDRDYPAKVRVKMETVEKTMKMD-D-GVEYRYWTFDGDVPGRMIRVREGDTVEVEFSNNPS 89
1NDR_A         2 LPRVAVDLVAPPLVHPHSQVAAGAPKVVQFRMSIEEKKMVAD-DdGTTAQAMTFNGSVPGPTLVVHEGDYIELTLVNPAT 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1NIB_A        91 NTLLHNIDFHAATGALGGGALTQVNPGEETTLRFKATKPGVFVYHCAPEGm-VPWHVTSGMNGAIMVLPRDGLKdekgqp 169
gi 2827765   129 NTLLHNIDFHAATGALGGGALTQVNPGEETTLRFKATKPGVFVYHCAPEGm-VPWHVTSGMNGAIMVLPRDGLKdekgqp 207
gi 730153    109 NSMPHNVDFHAATGALGGAGLTQVVPGQEVVLRFKADRSGTFVYHCAPQGm-VPWHVVSGMNGALMVLPRDGLRdpqgkl 187
gi 160358923 122 NTMPHNIDFHAATGALGGGGLTLINPGEKVVLRFKATRAGAFVYHCAPGGpmIPWHVVSGMAGCIMVLPRDGLKdhegkp 201
gi 30089160  123 NTMPHNVDFHAVAGPGGGAEATMTNPGETAHLRFKATYPGAYIYHCAVPN--MDMHISAGMFGLILVEPPEGLP------ 194
gi 8249446   129 NSMPHNIDLHAVRGPGGGAEASMVTPGQTKTFRFKATYPGAFIYHCAVPN--LDMHISSGMFGMILVEPKEGLP------ 200
gi 543809    130 STVPHNVDFHAATGQGGGAAATFTAPGRTSTFSFKALQPGLYIYHCAVAP--VGMHIANGMYGLILVEPKEGLP------ 201
gi 2842630   128 NTLQHNIDFHSATGALGGGALTVVNPGESAVLRFKATKAGVFVYHCAPPGm-VPWHVTSGMNGAIMVLPREGLTdghgke 206
2DWT_A        79 NTMPHNIDFHAATGALGGGGLTLINPGEKVVLRFKATRAGAFVYHCAPGGpmIPWHVVSGMAGCIMVLPRDGLKdhegkp 158
1KBW_A        90 STVPHNVDFHAATGQGGGAAATFTAPGRTSTFSFKALQPGLYIYHCAVAP--VGMHIANGMYGLILVEPKEGLP------ 161
1NDR_A        81 NSMPHNVDFHAATGALGGAGLTQVVPGQEAVLRFKADRSGTFVYHCAPAGm-VPWHVVSGMNGALMVLPRDGLR------ 153
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1NIB_A       170 lT-------YDKIYYVGEQDFYVPKDE--------AgnykkyetP--------GEAYEDAVKAMRTLTPTHIVFNGAVGA 226
gi 2827765   208 lT-------YDKIYYVGEQDFYVPKDE--------Agny--kkyEt------pGEAYEDAVKAMRTLTPTHIVFNGAVGA 264
gi 730153    188 lH-------YDRVYTIGESDLYIPKDK--------Dghy--kdyPd------lASSYQDTRAVMRTLTPSHVVFNGRVGA 244
gi 160358923 202 vR-------YDTVYYIGESDHYIPKDE--------Dgty--mrfSd------pSEGYEDMVAVMDTLIPSHIVFNGAVGA 258
gi 30089160  195 -E-------VDHEIYLGQHELYTDKDA--------G--------E--------EGQHTFDYEAMRNEDPTYVLMNGEKYA 242
gi 8249446   201 -E-------VDHEFYFGQHELYTTGDT--------G--------E--------KGHHDFDMEAMAAEEPTYVLMNGEKYA 248
gi 543809    202 -K-------VDKEFYIVQGDFYTKGKK--------G--------A--------QGLQPFDMDKAVAEQPEYVVFNGHVGS 249
gi 2842630   207 lV-------YDKVYYLGEQDFYIPRDE--------Kgef--kkyDs------pGEAYEDTVAVMRTLTPTHIVFNGAVGA 263
2DWT_A       159 vR-------YDTVYYIGESDHYIPKDEdgtymrfsD--------P--------SEGYEDMVAVMDTLIPSHIVFNGAVGA 215
1KBW_A       162 -K-------VDKEFYIVQGDFYTKGKK--------G--------A--------QGLQPFDMDKAVAEQPEYVVFNGHVGA 209
1NDR_A       154 -DaagaalaYDRVYTIGESDLYVPKAA--------D--------GnysdypalASAYADTVAVMRTLTPSHAVFNGAVGA 216
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1NIB_A       227 LTGDH-----ALTAAVGERVLVVHSQANRDTRPHLIGGHGDYVWATGKFRNPPDLDQETWLIPGGTAGAAFYTFRQPGVY 301
gi 2827765   265 LTGDH-----ALTAAVGERVLVVHSQANRDTRPHLIGGHGDYVWATGKFRNPPDLDQETWLIPGGTAGAAFYTFRQPGVY 339
gi 730153    245 LTGAN-----ALTSKVGESVLFIHSQANRDSRPHLIGGHGDWVWTTGKFANPPQRNMETWFIPGGSAVAALYTFKQPGTY 319
gi 160358923 259 LTGEG-----ALKAKVGDNVLFVHSQPNRDSRPHLIGGHGDLVWETGKFHNAPERDLETWFIRGGSAGAALYKFLQPGVY 333
gi 30089160  243 WTPNGrgpaaTVGTGETVRVYFVDGGPNLSSSFHPIGSVWETLYPEGSLTTEPQTHIQTRQVPPGSTTIATMSSPVPGDF 322
gi 8249446   249 ITPDRhg-spSMQVGETARVYFVTGGPNLDSSFHPIGSVWDEVWQQGSIAGPPNRYVQTTPVKPGSCAIATLHAEVPGPI 327
gi 543809    250 IAGDNa---lKAKAGETVRMYVGNGGPNLVSSFHVIGEIFDKVYVEGGKLINEN--VQSTIVPAGGSAIVEFKVDIPGSY 324
gi 2842630   264 LTGEN-----ALTAAVGERVLIVHSQANRDTRPHLIGGHGEYVWRTGKFVNVPDRDQETWFIPGPTRGAAYYTFEQPGIY 338
2DWT_A       216 LTGEG-----ALKAKVGDNVLFVHSQPNRDSRPHLIGGHGDLVWETGKFHNAPERDLETWFIRGGSAGAALYKFLQPGVY 290
1KBW_A       210 LTGDNa---lKAKAGETVRMYVGNGGPNLVSSFHVIGEIFDKVYVEGGKLINEN--VQSTIVPAGGSAIVEFKVDIPGNY 284
1NDR_A       217 LTGAN-----ALTAAVGESVLIIHSQANRDSRPHLIGGHGDWVWTTGKFANPPQLNMETWFIPGGSAAAALYTFKQPGTY 291
                        330       340       350
                 ....*....|....*....|....*....|....*..
1NIB_A       302 AYVNHNLIEAFELGAAGHFKVTGEWNDDLMTSVVKPA 338
gi 2827765   340 AYVNHNLIEAFELGAAGHFKVTGEWNDDLMTSVVKPA 376
gi 730153    320 VYLSHNLIEAMELGALAQIKVEGQWDDDLMTQVKAPG 356
gi 160358923 334 AYVNHNLIEAVHKGATAHVLVEGEWDNDLMEQVVAPV 370
gi 30089160  323 KLVDHSLSRVVRKGCMAVVRAEGPEDPEIFDPDPDPQ 359
gi 8249446   328 KLVDHALSRVARKATMAIINREGAANPDVFEPEA--- 361
gi 543809    325 TLVDHSIFRAFNKGALGQLKVEGAENPEIMTQKLSDT 361
gi 2842630   339 AYVNHNLIEAFELGAAAHFKVTGDWNDDLMTTVRSPS 375
2DWT_A       291 AYVNHNLIEAVHKGATAHVLVEGEWDNDLMEQVVAPV 327
1KBW_A       285 TLVDHSIFRAFNKGALGQLKVEGAENPEIMTQKLSDT 321
1NDR_A       292 AYLSHNLIEAMELGAAAQASVEGQWDDDLMTSVAAPG 328
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap