Conserved Protein Domain Family
MocE_fam_FeS

?
TIGR02377: MocE_fam_FeS 
Rieske [2Fe-2S] domain protein, MocE subfamily
This model describes a subfamily of the Rieske-like [2Fe-2S] family of ferredoxins that includes MocE, part of the rhizopine (3-O-methyl-scyllo-inosamine) catabolic cluster in Rhizobium. Members of this family are related to, yet distinct from, the small subunit of nitrite reductase [NAD(P)H].
Statistics
?
PSSM-Id: 131430
View PSSM: TIGR02377
Aligned: 3 rows
Threshold Bit Score: 185.843
Threshold Setting Gi: 15075551
Created: 8-Oct-2014
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 14024925    3 DWVEACATDDIDEEDVMRFDHGGRTFAIYRSPDDEYFATDGLCTHEKVHLADGLVMDDIIECPKHNGRFNYKTGAARGAP 82
gi 15075551    6 NWVKACDAKKVGREDVARWDHSGRSFAIFRTADDQYYATDDICTHEYAHISDGFVEGTTVECPRHAGCFDFRTGEALNPP 85
gi 499270682   2 TWVSACKLDDIEQEGAIRFDHGGRTYAIYRGPDDSVYCTAGLCTHEAIHLADGLVMDFEVECPKHSGAFDYRTGEAIRLP 81
                         90       100
                 ....*....|....*....|.
gi 14024925   83 VCVNLKTYPVKVDAGKVLVQV 103
gi 15075551   86 VCVNLRTFPVKVVDGAVYIDI 106
gi 499270682  82 ACENLKTYPAEVVDGEVRVAL 102
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap