Conserved Protein Domain Family
ECA_wecA

?
TIGR02380: ECA_wecA 
undecaprenyl-phosphate alpha-N-acetylglucosaminyl 1-phosphatetransferase
Members of this family are the WecA enzyme of enterobacterial common antigen biosynthesis, undecaprenyl-phosphate alpha-N-acetylglucosaminyl 1-phosphatetransferase. This family represents one narrow clade, and closely related sequences outside this clade may represent enzymes that catalyze the same specific reaction, but in the context of different pathways. A His-rich motif in a cytosolic loop of this integral membrane protein, shown critical to enzymatic activity for WecA is variously present or absent in the clade that includes Bacillus subtilis TagO teichoic acid biosynthesis enzyme, which may catalyze the same reaction as WecA. [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
Statistics
?
PSSM-Id: 131433
View PSSM: TIGR02380
Aligned: 6 rows
Threshold Bit Score: 487.666
Threshold Setting Gi: 46914261
Created: 8-Oct-2014
Updated: 11-Oct-2014
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 46914271   2 INAFIFVFITSFCSLFVFRKVAKYVGLVDKPNARKHHQGVVPLVGGVSIFFT-LAITFLLFTTIDSGLVLFLICATILVV 80
gi 46914261   3 FIELIVIFLLSFIFIFTLRRIAIIVDLVDKPSLRKSHCGFIPLVGGISIFLT-LSMVLFSHPALIIKYNVFLFCSSILVL 81
gi 28172993   2 FLELSFIFFSSFATLFLMRKVAKRIGLVDKPNARKLHTGSVPLVGGISICLV-LAQYLVFRPETINHSWLYLASIVLLTF 80
gi 2507110    7 STDLISIFLFTTLFLFFARKVAKKVGLVDKPNFRKRHQGLIPLVGGISVYAG-ICFTFGIVDYYIPHASLYLACAGVLVF 85
gi 1172919    1 MLSIFVTFLGAFLTLIVMRPLANWIGLVDKPNYRKRHQGTIPLIGGASLFVGnLCYYLMEWD-QLRLPYLYLFSIFVLLA 79
gi 49610881  15 MQDFIVVFLSAFAALFLARKVATIIGLVDKPCARKKHRGNIPLVGGVSIYCA-LCILFILHSDWLPDFSLYMVCATLLLV 93
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 46914271  81 MGVIDDRYDISFKIRLVIQAGVSLAMILIGDKSLHSLGYLMGSEAIELSpIASAMITIFAVIGAINAFNMVDGIDGLLGG 160
gi 46914261  82 TGIIDDKNNIQVNIRLAIQILVSIVAIQFGNISIHNLGAIFSPKELTLApLLSNIITILAIVGAMNAFNMIDGIDGLLGG 161
gi 28172993  81 VGALDDKFDLSFKIRMGIQAALSLVMMHAAGIELHSLGNLFGVGEIYLG-WVGSIITIFAVIGAINAFNMVDGIDGLLGG 159
gi 2507110   86 IGALDDRFDISVKIRATIQAAVGIVMMVFGKLYLSSLGYIFGSWEMVLG-PFGYFLTLFAVWAAINAFNMVDGIDGLLGG 164
gi 1172919   80 IGILDDRFDISPFLRAGIQAILAILMIDLGNIYLDHLGQILGPFQLTLG-SIGLIITVFATIAIINAFNMIDGIDGLLGG 158
gi 49610881  94 IGVIDDRFDLPVLPRFAVQTMVGGLMMYSG-LYLSSLGNVLFGHELLLG-GFGYVITLFAVCGAINAFNMIDGIDGLLGS 171
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 46914271 161 LASVTFGALGYLFLIDGNIELAMVCGLLVTAMIPYILLNLGFPLGRRFKVFMGDAGSIFIGFTVIWLLIEATQGVNSTPI 240
gi 46914261 162 VAIVVFSALGYLFWLNSNVELYYFCSIVIIAVIPYLILNLEFIFGKNLKVFMGDAGSLFIGFTVVWLLLNGTQANSSPSF 241
gi 28172993 160 LSIVTFGALAFLLNVDSQHGLAYLCVVIIVAMLPYILMNLG-ILGRKRKVFMGDAGSMMIGFTVIWLLLGVSQVESKPLM 238
gi 2507110  165 LSCVSFAAIGMILWFDGQTSLAIWCFAMIAAILPYIMLNLGI-LGRRYKVFMGDAGSTLIGFTVIWILLETTQGKTHP-I 242
gi 1172919  159 LSCVSFAAIGILMYRDGQMDMAHWSFALIVSILPYLMLNLGIPFGPKYKVFMGDAGSTLIGFTIIWILLLSTQGKGHP-M 237
gi 49610881 172 LSCIAFCSLFFLFYSGGERQLGLWSLCMMAATLPYLFLNLGIPLGKKFKVFMGDAGSTVIGFTVLWLLVLASQGETAV-M 250
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 46914271 241 RPVTALWVIALPLMDMATIMVRRIRKGQSPFKPDREHLHHICQRIGLSSHMSLFVICLCASIMASIGIWSDV-AQINETV 319
gi 46914261 242 KPVTALWLIAFPLMDMATIILNRIQNGRSPFQPDKQHLHHKLQVLGLPNRLILFILCGFSAIFAYIGIWSEI-NDVSEVV 320
gi 28172993 239 RPVTALWLIAVPLMDMAAIMIRRVRRGDSPFKPDREHLHHIFQRLGLTSRQTLVVICGFATLFAAFGIYGEA-ANLSEAF 317
gi 2507110  243 SPVTALWIIAIPLMDMVAIMYRRLRKGMSPFSPDRQHIHHLIMRAGFTSRQAFVLITLAAALLASIGVLAEYsHFVPEWV 322
gi 1172919  238 NPVTALWIIAIPLIDMVAIIYRRVRKGKSPFRPDRLHVHHLMVRAGLTSRQAFLLITFVSAVCATIGILGEV-YYVNEWA 316
gi 49610881 251 HPVTALWLIALPLIDMIAIMLRRFLRGDSPFKADRGHLHHILMSSGLTSRQSLMVITFAALLLAAVGIISDR-NNVSQSM 329
                       330       340
                ....*....|....*....|....*....
gi 46914271 320 MFVSFLAVFAVYFWVISHIWKITTWVHKL 348
gi 46914261 321 MLFSFSSLFVVYFILVSHLSVFFARLHSF 349
gi 28172993 318 MFYSFIACFLVYATLLNYVWRITSLSAAA 346
gi 2507110  323 MLVLFLLAFFLYGYCIKRAWKVARFIKRV 351
gi 1172919  317 MFVGFFILFFLYVYSITHAWRITRWVRRM 345
gi 49610881 330 MLSLFFVTFIGYFYFIPRIGKVLQLGRRT 358
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap