2FS5


Conserved Protein Domain Family
wecD_rffC

?
TIGR02382: wecD_rffC 
Click on image for an interactive view with Cn3D
TDP-D-fucosamine acetyltransferase
This model represents the WecD protein (Formerly RffC) for the biosynthesis of enterobacterial common antigen (ECA), an outer leaflet, outer membrane glycolipid with a trisaccharide repeat unit. WecD is a member of the GNAT family of acetytransferases (pfam00583). [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
Statistics
?
PSSM-Id: 131435
View PSSM: TIGR02382
Aligned: 4 rows
Threshold Bit Score: 313.831
Threshold Setting Gi: 152031664
Created: 8-Oct-2014
Updated: 23-Jan-2015
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2FS5_A        55 VQAKIAASNTGELDALQQLGFSLVEGEVDLALPVNN-----V----SDS-----GAVVAQETDIPALRQLASAAFAQSRF 120
gi 49613651   53 TQAKIAADNLVLADALADLGFRLVEGEVDLSLPLHP-----TtvvtPLP-----RWREATLDDIPALRDAASRVFALSRF 122
gi 152031664  44 VQAKIAASNTGELDALQQLGFSLVEGEVDLALPVNNa---------SDS-----GAVVAQETDIPALRQLASAAFAQSRF 109
gi 45437804   63 VQAKVPTHRLDLIDALSQLDFHLVEGEIDLSLVVGEkegigTenatSEPnmgaySLRVATEADIPQLRRVAASAFALSRF 142
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2FS5_A       121 RAPWYAPDASGRFYAQWIENAVRGTFDHQCLILRAASGDIRGYVSLRELNATDARIGLLAG------RGAGAELMQTALN 194
gi 49613651  123 RTPWYQPEDSGRFYAQWVENAVCGTFDHSCLMMEDAAGHPQGWVTLRRLDDSDARIGLLGVwpgvtiRGIGSQLMALAEA 202
gi 152031664 110 RAPWYAPDASSRFYAQWIENAVRGTFDHQCLILRAASGDIRGYVSLRELNATDARIGLLAG------RGAGAELMQTALN 183
gi 45437804  143 RAPWYDAQDSGRFYALWVEKAVLGTFDHQCLLVLDPTDQPVGFVTLRDLQDGSARIGLLAVfpgaqsKGIGLRLMSAAKQ 222
                        170       180       190       200
                 ....*....|....*....|....*....|....*....|.
2FS5_A       195 WAYARGKTTLRVATQMGNTAALKRYIQSGANVESTAYWLYR 235
gi 49613651  203 WCRQQGLIRLRVATQVGNVAALRLYLRRGATIESTAYWLYR 243
gi 152031664 184 WAYARGKTTLRVATQMGNTAALKRYIQSGANVESTAYWLYR 224
gi 45437804  223 WCQHHGLHRLRVATQMSNIAALRLYIRSGASIESTAYWLCR 263
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap