Conserved Protein Domain Family
rpoC1_cyan

?
TIGR02387: rpoC1_cyan 
DNA-directed RNA polymerase, gamma subunit
The RNA polymerase gamma subunit, encoded by the rpoC1 gene, is found in cyanobacteria and corresponds to the N-terminal region the beta' subunit, encoded by rpoC, in other bacteria. The equivalent subunit in plastids and chloroplasts is designated beta', while the product of the rpoC2 gene is designated beta''.
Statistics
?
PSSM-Id: 131440
View PSSM: TIGR02387
Aligned: 3 rows
Threshold Bit Score: 1270.67
Threshold Setting Gi: 41017916
Created: 8-Oct-2014
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 41017923  11 HFDYVKITLASPERVMEWGQRTLPNGQVVGEVTKPETINYRTLKPEMDGLFCEKIFGPSKDWECHCGKYKRVRHRGIVCE 90
gi 41017916   7 RFDYIKISIASPERVMAWGQRTLPNGQVVGEVTKPETINYRTLKPEMDGLFCERIFGPSKDWECYCGKYKRVRHRGIVCE 86
gi 2500623    8 RFDYVKIAIASPERIRQWGERTLPNGTVVGEVTKPETINYRTLKPEMDGLFCEKIFGPSKDWECWCGKYKRVRHRGIVCE 87
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 41017923  91 RCGVEVTESRVRRHRMGFIKLAAPVSHVWYLKGIPSYVAILLDMPLRDVEQIVYFNCYVVLDPGDHKELKYKQLLTEDEW 170
gi 41017916  87 RCGVEVTESKVRRHRMGYIKLAAPVTHVWYLKGIPSYISTLLDMPLRDVEQVVYFNAYVVLNPGNAENLYYKQLLTEDQY 166
gi 2500623   88 RCGVEVTESRVRRHRMGYIKLAAPVTHVWYLKGIPSYLSILLDMALRDVEQIVYFNAYVVLNPGNASNLQYKQLLTEDQW 167
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 41017923 171 LEIEDEIYAEESEIENEP-VVGIGAEALKQLLEDLNLEEVAEQLREEINGSKGQKRAKLIKRLRVIDNFVATSARPEWMV 249
gi 41017916 167 IEVEDQIFAEDSSLELPEgWAKMGAEAIHELLAAIEMESEAERLRADLGESKGQKRTKLIKRLRVLDNFIATGSRPEWMV 246
gi 2500623  168 VEIEDQIYAEDSELEGIE--VGIGAEAVQRLLAELQLEEVAEKLREEILASKGQKRAKLIKRLRVIDNFIATHSQAEWMT 245
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 41017923 250 LDVIPVIPPDLRPMVQLDGGRFATSDLNDLYRRVINRNNRLARLQEILAPEIIVRNEKRMLQEAVDALIDNGRRGRTVVG 329
gi 41017916 247 LTAIPVIPPDLRPMVQLDGGRFATSDLNDLYRRVINRNNRLARLQEILAPEIIVRNEKRMLQEAVDALIDNGRRGRTVVG 326
gi 2500623  246 LDVIPVIPPDLRPMVQLDGGRFATSDLNDLYRRVINRNNRLARLQEILAPEIIVRNEKRMLQEAVDALIDNGRRGRTVVG 325
                       330       340       350       360       370       380       390       400
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 41017923 330 ANNRPLKSLSDIIEGKQGRFRQNLLGKRVDYSGRSVIVVGPKLKMHQCGLPKEMAIELFQPFVIHRLIRQNIVNNIKAAK 409
gi 41017916 327 ANNRPLKSLSDIIEGKQGRFRQNLLGKRVDYSGRSVIVVGPKLKLHQCGLPKEMAIELFQPFVIHKLIQRGLVNNIKAAK 406
gi 2500623  326 ANNRALKSLSDIIEGKQGRFRQNLLGKRVDYSGRSVIVVGPNLKIYQCGLPREMAIELFQPFVIHRLIKLGIVNNIKAAK 405
                       410       420       430       440       450       460       470       480
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 41017923 410 KLIQRADDEVMQVLQEVIDGHPIMLNRAPTLHRLGIQAFEPKLVDGRAIQLHPLVCPAFNADFDGDQMAVHVPLAIEAQT 489
gi 41017916 407 KMIQRNDARIWSVLDEVITGHPVLLNRAPTLHRLGIQAFEPILVSGRAIQLHPLVCTAFNADFDGDQMAVHVPLSLESQA 486
gi 2500623  406 KLILKGDPQIWSVLEEVITGHPVMLNRAPTLHRLGIQAFEPILVEGRAIQLHPLVCPAFNADFDGDQMAVHVPLSLEAQC 485
                       490       500       510       520       530       540       550       560
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 41017923 490 EARMLMLASNNILSPATGEPIVTPSQDMVLGSYYLTALQPGAEQpefgDRSRTYSSLEDVIHAFEDTRIGLHDWVWVR-F 568
gi 41017916 487 EARLLMLASNNVLSPATGRPIITPTQDMVLGCYYLTVDNPDATK----GSGKYFGSSEDAVIAYNQGMIDLHAKIWLR-F 561
gi 2500623  486 EARLLMLACHNVLSPATGKPIVAPSQDMVLGCYYLTAENPNAQK----GAGRYFAGIEDALRAYDHGQVDLHSQIWIRhL 561
                       570       580       590       600       610       620
                ....*....|....*....|....*....|....*....|....*....|....*....|....*
gi 41017923 569 NGEVEDNDEldepiksETLsdgtrieqwtyrRDRFDEDGALISRYILTTTGRVVMNHTIIGAVAA 633
gi 41017916 562 EGEVETDNP-------EDL------------RVRRDEQGNALSQFVRTTVGRIIFNQVIQETLVA 607
gi 2500623  562 DEDVVTEKPdteviktEDLgdgtvmkyyrerKIREGVDGEIITQYIQTTPGRIIYNKTIAEALVF 626
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap