Conserved Protein Domain Family
salt_tol_Pase

?
TIGR02399: salt_tol_Pase 
glucosylglycerol 3-phosphatase
Proteins in this family are glucosylglycerol-phosphate phosphatase, with the gene symbol stpA (Salt Tolerance Protein A). A motif characteristic of acid phosphatases is found, but otherwise this family shows little sequence similarity to other phosphatases. This enzyme acts on the glucosylglycerol phosphate, product of glucosylglycerol phosphate synthase and immediate precursor of the osmoprotectant glucosylglycerol.
Statistics
?
PSSM-Id: 131452
View PSSM: TIGR02399
Aligned: 3 rows
Threshold Bit Score: 716.624
Threshold Setting Gi: 15214311
Created: 8-Oct-2014
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15214311  17 QTLAQTENLLIVQDLDGVCMELVQDPLSRRLDADYVRATTLFAEHFYVLTNGEHVGKRGVQGIVEQSFGDASFVQQEGLY 96
gi 33635052  11 AEMVSTEDLLIVQDLDGVCIPLVKDPLTRVLDPAYVWAAKSLEGSFSVLTNGEHGGHRGVNCVVERALGDPQLPAKQGLY 90
gi 33639928  10 EIIINSKNILFIQDIDGVCIPLVKDPMTRKLESKFIFAVKNLEKEFYVLTCGEHEGPRGVNRIVERSLIGIDQPKEKGLY 89
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15214311  97 LPGLAAGGVQWQDRHGKVSHPGVGQTELEFLAAVPEKITNCLKTFFGDRPHSLSPEQLQTGIEASVLDNVASPTANLNTL 176
gi 33635052  91 LPGLAAGGVQLQNCYGEISHPGISDAEIAFLAALPSRMKTLLEQRLPALLPQITSDEIQTLAKMSVLDTELSPTILLNGL 170
gi 33639928  90 LRGLAACGVEYQDNNGNISFEGVSKEEVDFLAKVPDLMRPSFEQIVKKIFPNLVQEEINSHASKSICKTRFSPTINFNSL 169
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15214311 177 ANLLQDFPQIYRDLQETMAQLLDQLMAEAVAQGLGNSFFVHYAPNLGRDERgKEIIRWAKAGDSGTTDFQFMLRGGVKEA 256
gi 33635052 171 FSLSPDDVGIQQSLQIMLHELMNELMNSAISAGLPNSFFLHIAPNMGCDGQ-RERLKPAAPGDVGTTDIQFMLKGAVKEA 249
gi 33639928 170 FDLVKDDSEKRKIIQKSFEDMMNEIIYKAKTQGLENSFFLHISPNLGSKNG-NEIIKLSSKNDIGSTDIQLLIKGAVKDS 248
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15214311 257 GVLALLNRYYHNRTGQYPLGESFSARQAPPSHQDLLHLVKAQFDPALMPLIIGVGDTVTSQVDEATGEIRRGGSDRQFLQ 336
gi 33635052 250 GLVVLINKHIAKHKGRAPLGKDFDVRSAPKTHQGLLDLCRKHIPVDQMPLLMGVGDTVTSNPSPDGTGWLRGGSDRGFLT 329
gi 33639928 249 GVLFLLNKFIYDSTGIAPFGRNFNFKDSPKSLIEKVNFCKKHIKPEDMPTIIGIGDTVTSQKIPN-NGYSRGGSDRSFLE 327
                       330       340       350       360       370       380       390       400
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15214311 337 LIQDLGDWGNHGNLVVYVDSSQGEVKnRQPLQLETVAGqtqvvagpgdMRDREEPLKINVAFPGGHDQYVAAFKQAAQRR 416
gi 33635052 330 LLQNLGATYNRTNRVVLVDSSGGEVY-RPSLADERLQG----------ISDPEDPLHFDVLVPSGPSTYVAWFRSLAERR 398
gi 33639928 328 FIQLLGQEFESNNKIIFVDSSSGEVY-RPSTKISGLKG----------ISDDDDNLKFDMIFQNGPKEYLDWFIKFAKNR 396

                .
gi 15214311 417 R 417
gi 33635052 399 S 399
gi 33639928 397 S 397
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap