Conserved Protein Domain Family
trehalos_R_Ecol

?
TIGR02405: trehalos_R_Ecol 
trehalose operon repressor, proteobacterial
This family consists of repressors of the LacI family typically associated with trehalose utilization operons. Trehalose is imported as trehalose-6-phosphate and then hydrolyzed by alpha,alpha-phosphotrehalase to glucose and glucose-6-P. This family includes repressors mostly from Gammaproteobacteria and does not include the GntR family TreR of Bacillus subtilis [Regulatory functions, DNA interactions]
Statistics
?
PSSM-Id: 131458
View PSSM: TIGR02405
Aligned: 3 rows
Threshold Bit Score: 552.955
Threshold Setting Gi: 46912844
Created: 8-Oct-2014
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 731001     4 RLTIKDIARLSGVGKSTVSRVLNNESGVSQLTRERVEAVMNQHGFSPSRSARAMRGQSDKVVAIIVTRLDSLSENLAVQT 83
gi 36786603   4 KLTIKDIARLANVSKSTVSRVLNNENSVSPQVRERVETIIQQNNFIPSKSARAMRVKSDKIIALIVSRLGSFSENLSISA 83
gi 46912844   4 KLTILDIAKLAGVGKSTVSRVLTNDPKVKIETRERVEQVIQESGFVPSKSAQAMRGGSAKVVGVIISRLDSPSENKAVSG 83
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 731001    84 MLPAFYEQGYDPIMMESQFSPQLVAEHLGVLKRRNIDGVVLFGFTGITEEMLAHWQSSLVLLARDAKGFASVCYDDEGAI 163
gi 36786603  84 MLPLFYQHGYDPIIMESNFDPQLLQEHLRQLALRHADGIILFGFTGLSEESLFPWRDKMVVFAREYTGFSSVCYDDIGAV 163
gi 46912844  84 ILDVIYTAGYDAVIMESQFSAEKTNEHLSVLQKRNVDGVILFGFSGCDLSIVESLNHKAVVIAVDTGRISSVGYDNYGII 163
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 731001   164 KILMQRLYDQGHRNISYLGVPHSDVTTGKRRHEAYLAFCKAHKLHPVAALPGLAMKQGYENVAKVITPETTALLCATDTL 243
gi 36786603 164 RLLMNEFYRRGHREISFLGVDDCDTTTGFLRHQSYLACCEQQGLRPLSVQCDLSYQSGFQHINKVLREKTTALICATDSL 243
gi 46912844 164 ELAMANLQQQGKQHISFIGVDPSDKTTGLMRLNAYIEYCESANIEPIYQTGQLSHESAYVLTDHVLKPETEAIVCASDTL 243
                       250       260       270       280       290       300       310
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|.
gi 731001   244 ALGASKYLQEQRIDTLQLASVGNTPLMKFLHPEIVTVDPGYAEAGRQAACQLIAQVTGRSEPQQIIIPATL 314
gi 36786603 244 ALGAYKYLQQNSREDIQIGSIGNTPLLNFLYPNTVSIDLGYSEAGKYASDQLISQINRQYFKQKVIIPSKL 314
gi 46912844 244 AMGVAKRLQELDRSDVLVSGVGATDLLSFIFPNTFSIDPGYYAAGKASASLLIKQLAGCHEVTHLTQKAMI 314
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap