Conserved Protein Domain Family
ectoine_ThpD

?
TIGR02408: ectoine_ThpD 
ectoine hydroxylase
Both ectoine and hydroxyectoine are compatible solvents that serve as protectants against osmotic and thermal stresses. A number of genomes synthesize ectoine. This enzyme allows conversion of ectoine to hydroxyectoine, which may be more effective for some purposes, and is found in a subset of ectoine-producing organisms.
Statistics
?
PSSM-Id: 131461
View PSSM: TIGR02408
Aligned: 3 rows
Threshold Bit Score: 516.369
Threshold Setting Gi: 118469035
Created: 8-Oct-2014
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33576631   21 ARQDPVVYGEGKFADALSADQVQSYERDGFLLLENLFSDEEVAALLAEVERMTRDPAIVRREEAITEPGSNAVRSIFMVH 100
gi 41393724   21 PRQDPVIWSAPGAPGPVAAKDLQGYEHDGFLTVDQLIAPDEVAVYQAELNRLISDPAVRADERSIVEKQSQNVRSVFEVH 100
gi 489992292  32 PRADPTVWGS-EADGPLNQKNLDHFSSQGYLVRHGTVTNDWLPHLRQEMDRIAAD--LDHDDPRVIREPGGSIRSIFEPH 108
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33576631  101 VLSPILGRLVRDPRLANAARQILGSEVYVHQSRANMKPGFKGKEFYWHSDFETWHVEDGMPSMRALSCSVLLTDNNETNG 180
gi 41393724  101 RISEVFAGLVRDERVVGRARQILGSDVYVHQSRINVKPGFGATGFYWHSDFETWHAEDGLPNMRTVSVSIALTENFDTNG 180
gi 489992292 109 LLSDLVAQVVRLDTVLPVARQLLGSDVYIHQARINMMPGFTGTGFYWHSDFETWHAEDGMPAIRAVSCSIALTRNYPYNG 188
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33576631  181 PLMLVPGSHRQFISCVGETPRDHYKQSLKKQEYGVPDPVSLQLLAEQGGISTMTGKAGSVVFFDCNTMHGSNSNISPWPR 260
gi 41393724  181 GLMIMPGSHKTFLGCAGETPKDNYKKSLQMQDAGTPSDEALTKMADRHGIRLFTGRAGSATWFDCNAMHGSGDNITPYAR 260
gi 489992292 189 SLMVIPGSHQTFYPCVGETPQDNHDTSLVAQTVGVPDETTLTKAVDHAGIDQFTGAAGSALWFDANLLHGSGSNITPLPR 268
                        250       260       270
                 ....*....|....*....|....*....|....*...
gi 33576631  261 ANVFMVYNSMENTLNPPKYGLNPRPEHIATRQaFKAVR 298
gi 41393724  261 SNVFIVFNSVENAAQEPFAAPIRRPEFIGARD-FTPVK 297
gi 489992292 269 SNVFLVFNSVDNALEEPFAAPRRRPEYLAARR-VAPVT 305
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap