1N5W,1FFU


Conserved Protein Domain Family
CO_dehy_Mo_lg

?
TIGR02416: CO_dehy_Mo_lg 
Click on image for an interactive view with Cn3D
carbon-monoxide dehydrogenase, large subunit
This model represents the large subunits of group of carbon-monoxide dehydrogenases that include molybdenum as part of the enzymatic cofactor. There are various forms of carbon-monoxide dehydrogenase; Salicibacter pomeroyi DSS-3, for example, has two forms. Note that, at least in some species, the active site Cys is modified with a selenium attached to (rather than replacing) the sulfur atom. This is termed selanylcysteine, and created post-translationally, in contrast to selenocysteine incorporation during translation as for many other selenoproteins. [Energy metabolism, Other]
Statistics
?
PSSM-Id: 131469
View PSSM: TIGR02416
Aligned: 5 rows
Threshold Bit Score: 1474.39
Threshold Setting Gi: 118467964
Created: 8-Oct-2014
Updated: 23-Jan-2015
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1N5W_B        29 EDIRFTQGKGNYVDDVKLPGMLFGDFVRSSHAHARIKSIDTSKAKALPGVFAVLTAADLKPLNLHYMPTLAGDVQAVLAD 108
gi 21903401   26 EDARFIQGKGNYVDDIKMPGMLHMDIVRAPIAHGRIKKIHKDAALAMPGVHAVLTAEDLKPLKLHWMPTLAGDVAAVLAD 105
gi 500046444  31 EDPRFIRGRGNYVDDVKLPGMLHLAILRSPYAHATINSIDVTAAQAHPKVKAVVTGADLAAKGLAWMPTLSNDVQAVLAT 110
gi 21903404   29 EDIRFTQGKGNYVDDVKLPGMLFGDFVRSSHAHARIKSIDTSKAKALPGVFAVLTAADLKPLNLHYMPTLAGDVQAVLAD 108
1FFU_B        26 EDARFIQGKGNYVDDIKMPGMLHMDIVRAPIAHGRIKKIHKDAALAMPGVHAVLTAEDLKPLKLHWMPTLAGDVAAVLAD 105
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1N5W_B       109 EKVLFQNQEVAFVVAKDRYVAADAIELVEVDYEPLPVLVDPFKAMEPDAPLLREDIKDKMTGAHGARKHHNHIFRWEIGD 188
gi 21903401  106 EKVHFQMQEVAIVIADDRYIAADAVEAVKVEYDELPVVIDPIDALKPDAPVLREDLAGKTSGAHGPREHHNHIFTWGAGD 185
gi 500046444 111 DKVRFQGQEVAFVVAEDRYSARDALELIDVDYEPLDPVIDARHALDPGAPVIRTDLDGKTD---------NHCFDWETGD 181
gi 21903404  109 EKVLFQNQEVAFVVAKDRYVAADAIELVEVDYEPLPVLVDPFKAMEPDAPLLREDIKDKMTGAHGARKHHNHIFRWEIGD 188
1FFU_B       106 EKVHFQMQEVAIVIADDRYIAADAVEAVKVEYDELPVVIDPIDALKPDAPVLREDLAGKTSGAHGPREHHNHIFTWGAGD 185
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1N5W_B       189 KEGTDATFAKAEVVSKDMFTYHRVHPSPLETCQCVASMDKIKGELTLWGTFQAPHVIRTVVSLISGLPEHKIHVIAPDIG 268
gi 21903401  186 KAATDAVFANAPVTVSQHMYYPRVHPCPLETCGCVASFDPIKGDLTTYITSQAPHVVRTVVSMLSGIPESKVRIVSPDIG 265
gi 500046444 182 AAATDAVFAKADVVVKQEMVYPRVHPAPMETCGAVADLDPVTRKLTLWSTTQAPHAHRTLYALVAGLPEHKIRVISPDIG 261
gi 21903404  189 KEGTDATFAKAEVVSKDMFTYHRVHPSPLETCQCVASMDKIKGELTLWGTFQAPHVIRTVVSLISGLPEHKIHVIAPDIG 268
1FFU_B       186 KAATDAVFANAPVTVSQHMYYPRVHPCPLETCGCVASFDPIKGDLTTYITSQAPHVVRTVVSMLSGIPESKVRIVSPDIG 265
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1N5W_B       269 GGFGNKVGAYSGYVCAVVASIVLGVPVKWVEDRMENLSTTSFARDYHMTTELAATKDGKILAMRCHVLADHGAFDACADP 348
gi 21903401  266 GGFGNKVGIYPGYVCAIVASIVLGRPVKWVEDRVENISTTAFARDYHMDGELAATPDGKILGLRVNVVADHGAFDACADP 345
gi 500046444 262 GGFGNKVPIYPGYVCAIVGSLLLGKPVKWMEDRSENLTSTGFARDYIMVGEIAATRDGKILAIRSNVLADHGAFNGTAAP 341
gi 21903404  269 GGFGNKVGAYSGYVCAVVASIVLGVPVKWVEDRMENLSTTSFARDYHMTTELAATKDGKILAMRCHVLADHGAFDACADP 348
1FFU_B       266 GGFGNKVGIYPGYVCAIVASIVLGRPVKWVEDRVENISTTAFARDYHMDGELAATPDGKILGLRVNVVADHGAFDACADP 345
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1N5W_B       349 SKWPAGFMNICTGSYDMPVAHLAVDGVYTNKASGGVAYRCSFRVTEAVYAIERAIETLAQRLEMDSADLRIKNFIQPEQF 428
gi 21903401  346 TKFPAGLFHICSGSYDIPRAHCSVKGVYTNKAPGGVAYRCSFRVTEAVYLIERMVDVLAQKLNMDKAEIRAKNFIRKEQF 425
gi 500046444 342 VKYPAGFFGVFTGSYDIEAAYCHMTAVYTNKAPGGVAYACSFRITEAVYFVERLVDCLAYELKMDPAQLRLQNLLKAEQF 421
gi 21903404  349 SKWPAGFMNICTGSYDMPVAHLAVDGVYTNKASGGVAYRCSFRVTEAVYAIERAIETLAQRLEMDSADLRIKNFIQPEQF 428
1FFU_B       346 TKFPAGLFHICSGSYDIPRAHCSVKGVYTNKAPGGVAYXXSFRVTEAVYLIERMVDVLAQKLNMDKAEIRAKNFIRKEQF 425
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1N5W_B       429 PYMAPLGWEYDSGNYPLAMKKAMDTVGYHQLRAEQKAKQeafKRGE---TREIMGIGISFFTEIVGAGPSKNCDILGVSM 505
gi 21903401  426 PYTTQFGFEYDSGDYHTALKKVLDAVDYPAWRAEQAARR---ADPN---SPTLMGIGLVTFTEVVGAGPSKMCDILGVGM 499
gi 500046444 422 PYTSKTGWVYDSGDYEKTMRLAMEMVDYEGLRAEQAEKR---KRGE------LMGIGMSFFTEAVGAGPRKDMDILGLGM 492
gi 21903404  429 PYMAPLGWEYDSGNYPLAMKKAMDTVGYHQLRAEQKAKQ---EAFKrgeTREIMGIGISFFTEIVGAGPSKNCDILGVSM 505
1FFU_B       426 PYTTQFGFEYDSGDYHTALKKVLDAVDYPALRAEQAARR---ADPN---SPTLMGIGLVTFTEVVGAGPSKMCDILGVGM 499
                        490       500       510       520       530       540       550       560
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1N5W_B       506 FDSAEIRIHPTGSVIARMGTKSQGQGHETTYAQIIATELGIPADDIMIEEGNTDTAPYGLGTYGSRSTPTAGAATAVAAR 585
gi 21903401  500 FDSCEIRIHPTGSAIARMGTITQGQGHQTTYAQIIATELGIPSEVIQVEEGDTSTAPYGLGTYGSRSTPVAGAAIALAAR 579
gi 500046444 493 ADGCELRVHPTGKAVVRLSVQSQGQGHETTFAQIVAEELGIPPEDIDVVHGDTDQTPFGLGTYGSRSTPVSGAAAALVAR 572
gi 21903404  506 FDSAEIRIHPTGSVIARMGTKSQGQGHETTYAQIIATELGIPADDIMIEEGNTDTAPYGLGTYGSRSTPTAGAATAVAAR 585
1FFU_B       500 FDSCEIRIHPTGSAIARMGTITQGQGHQTTYAQIIATELGIPSEVIQVEEGDTSTAPYGLGTYGSRSTPVAGAAIALAAR 579
                        570       580       590       600       610       620       630       640
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1N5W_B       586 KIKAKAQMIAAHMLEVHEGDLEWDVDRFRVKGLPEKFKTMKELAWASYNS--PPPNLEPGLEAVNYYDPPNMTYPFGAYF 663
gi 21903401  580 KIHAKARKIAAHMLEVNENDLDWEVDRFKVKGDDSKFKTMADIAWQAYHQ--PPAGLEPGLEAVHYYDPPNFTYPFGIYL 657
gi 500046444 573 KVRDKAKIIAAGMLEASIADLEWDKGSFHIKGDPSASVTIADIAMRAHGAgdLPEGLEGGLDAQICYNPSNLTYPYGAYF 652
gi 21903404  586 KIKAKAQMIAAHMLEVHEGDLEWDVDRFRVKGLPEKFKTMKELAWASYNS--PPPNLEPGLEAVNYYDPPNMTYPFGAYF 663
1FFU_B       580 KIHAKARKIAAHMLEVNENDLDWEVDRFKVKGDDSKFKTMADIAWQAYHQ--PPAGLEPGLEAVHYYDPPNFTYPFGIYL 657
                        650       660       670       680       690       700       710       720
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1N5W_B       664 CIMDIDVDTGVAKTRRFYALDDCGTRINPMIIEGQVHGGLTEAFAVAMGQEIRYDEQGNVLGASFMDFFLPTAVETPKWE 743
gi 21903401  658 CVVDIDRATGETKVRRFYALDDCGTRINPMIIEGQIHGGLTEGYAVAMGQQMPFDAQGNLLGNTLMDYFLPTAVETPHWE 737
gi 500046444 653 CVVDIDPGTAVVKVRRFVAVDDCGTRINPMIIEGQIHGGLVDGIGMALMEMIAFDEDGNCLGGSLMDYLIPTAMEVPHFE 732
gi 21903404  664 CIMDIDVDTGVAKTRRFYALDDCGTRINPMIIEGQVHGGLTEAFAVAMGQEIRYDEQGNVLGASFMDFFLPTAVETPKWE 743
1FFU_B       658 CVVDIDRATGETKVRRFYALDDCGTRINPMIIEGQIHGGLTEGYAVAMGQQMPFDAQGNLLGNTLMDYFLPTAVETPHWE 737
                        730       740       750       760       770
                 ....*....|....*....|....*....|....*....|....*....|....*...
1N5W_B       744 TDYTVTPSPHHPIGAKGVGESPHVGGVPCFSNAVNDAYAFLNAGHIQMPHDAWRLWKV 801
gi 21903401  738 TDHTVTPSPHHPIGAKGVAESPHVGSIPTFTAAVVDAFAHVGVTHLDMPHTSYRVWKS 795
gi 500046444 733 TGHTVTPSPHHPIGAKGIGESATVGSPPAVVNAVVDALAPYGVRHADMPLTPSRVWEA 790
gi 21903404  744 TDYTVTPSPHHPIGAKGVGESPHVGGVPCFSNAVNDAYAFLNAGHIQMPHDAWRLWKV 801
1FFU_B       738 TDHTVTPSPHHPIGAKGVAESPHVGSIPTFTAAVVDAFAHVGVTHLDMPHTSYRVWKS 795
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap