Conserved Protein Domain Family
fruct_sucro_rep

?
TIGR02417: fruct_sucro_rep 
D-fructose-responsive transcription factor
Members of this family belong the lacI helix-turn-helix family (pfam00356) of DNA-binding transcriptional regulators. All members are from the proteobacteria. Characterized members act as positive and negative transcriptional regulators of fructose and sucrose transport and metabolism. Sucrose is a disaccharide composed of fructose and glucose; D-fructose-1-phosphate rather than an intact sucrose moiety has been shown to act as the inducer. [Regulatory functions, DNA interactions]
Statistics
?
PSSM-Id: 131470
View PSSM: TIGR02417
Aligned: 5 rows
Threshold Bit Score: 499.277
Threshold Setting Gi: 24982197
Created: 8-Oct-2014
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 120534     2 KLDEIARLAGVSRTTASYVINGKAKQYRVSDKTVEKVMAVVREHNYHPNAVAAGLRAGRTRSIGLVIPDLENTSYTRIAN 81
gi 24982197   2 KLSDIARLAGVSVTTASYVINGKAEQQRISNSTVERVRAVVEAHGFTPNPQAAGLRSRHTRTLGFILPDLENPSYARIAK 81
gi 28809049   2 TLDEIAKLAGVSKTTASYVINGKAQKYRISEKTQKKVMAVVDEYNYKPDHAASSLRAGNSRSFGLIIPDLENTSYARLAK 81
gi 548906     7 TIKDIAELAGVSKATASLVLNGRGKELRVAQETRERVLAIAREQHYQPSIHARSLRDNRSHTIGLVVPEITNYGFAVFSH 86
gi 12722273  10 TLSDIAKCCGLSTTTVSMILNNRGEEFKIKAETCQRVKAIAEQQGYRANVYAKSLKMQRSNVIGFVIPDLTNYGFACTAK 89
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 120534    82 YLERQARQRGYQLLIACSEDQPDNEMRCIEHLLQRQVDAIIVSTSLPPEHPFYQRWANDPFPIVALDRALDREHFTSVVG 161
gi 24982197  82 QLEQGARARGYQLLIASSDDQPDSERQLQQLFRARRCDALFVASCLPPEDDSYRELQDKGLPVIAIDRRLDPAHFCSVIS 161
gi 28809049  82 LIEQNSRKAGYQILIGCSDDDPETEKKVAEALISRRIDALFVASGMPSANEYYLKLQNSGTPVIALDRPMDDEHFCCVIS 161
gi 548906    87 ELETLCREAGVQLLISCTDENPGQESVVVNNMIARQVDGLIVASCMH-SDADYQKLS-EQLPVVLFDRSPSDSALPLVMT 164
gi 12722273  90 ILEKQCRENGLQLIIACSDDNPQQEKLAIERLLDRQIDFLITAPTHQ-DPSYYQKIG-QHTPILQLDRYVPDLALNYVIS 167
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 120534   162 ADQDDAEMLAEELRKFP-AETVLYLGALPELSVSFLREQGFRTAWKDD--PREVHFLYANSYEREAAAQLFEKWLETHP- 237
gi 24982197 162 DDRDASRQLAASLLSSA-PRSIALIGARPELSVSQARAGGFDEALQGY--TGEVRRYQGEAFSRECGQRLMQQLIDDLGg 238
gi 28809049 162 EDFDAAFELTESVLSPE-IKTIGLIGALQDLQVSKERELGFRSACQKD--DTAMTVGYGLHFSREEGKKVLDKWVQADS- 237
gi 548906   165 DSVTPTAELISRIAPQH-ADEFWFLGGQPRLSPSRDRLAGFTQGLAQAgiTLRPEWVINGNYHPSSGYEMFAALCARLGr 243
gi 12722273 168 NDSEHITALICRLCDQYqLTEFMYFGGQRTLSPSESRLAGFLQGLKQAnlNLKKEWILHRTYQPESGYQMLAETEAKLGr 247
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 120534   238 MPQALFTTSFALLQGVMDVTLRRDg---KLPSDLAIATFGDNELLDFLQCPVLAVAQRHRDVAERVLEIVLASLDePRKP 314
gi 24982197 239 LPDALVTTSYVLLQGVFDTLQARP----VDSRQLQLGTFGDNQLLDFLPLPVNAMAQQHGQIAATALELALAAIE-EKRY 313
gi 28809049 238 LPDAIVTTSYTLLEGVLDVMLEKP----ELMSQVRLATFGDNRLLDFLPVKINSLPQQFELIADSAMELALNAS--AKRY 311
gi 548906   244 PPKALFTAACGLLEGVLRYMSQHH----LLDSNIHLASFDDHYLYDSLSLRIDTVQQDNRQLAWHCYDLLSQLID-GQAP 318
gi 12722273 248 LPQAIFTASYTLLEGVLRYLTEQKkmdlLLNRQLHLATFDDHDILNALPFHIHSIKQNHPQLAHQIFQHIMRYFA-GKK- 325
                       330
                ....*....|....*
gi 120534   315 KPGLTRIKRNLYRRG 329
gi 24982197 314 EPGVHAVGRTFKQRI 328
gi 28809049 312 KPGVELIPRKIVKRQ 326
gi 548906   319 EPLQRYLPATLQIRH 333
gi 12722273 326 SPNQK-IDCDVIYRD 339
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap