2PCD,1EO2


Conserved Protein Domain Family
protocat_beta

?
TIGR02422: protocat_beta 
Click on image for an interactive view with Cn3D
protocatechuate 3,4-dioxygenase, beta subunit
This model represents the beta chain of protocatechuate 3,4-dioxygenase. The most closely related family outside this family is that of the alpha chain (TIGR02423), typically encoded in an adjacent locus. This enzyme acts in the degradation of aromatic compounds by way of p-hydroxybenzoate to succinate and acetyl-CoA. [Energy metabolism, Other]
Statistics
?
PSSM-Id: 131475
View PSSM: TIGR02422
Aligned: 14 rows
Threshold Bit Score: 394.405
Threshold Setting Gi: 11037226
Created: 8-Oct-2014
Updated: 23-Jan-2015
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2PCD_M        16 HPKALTPDYKTSIARSPRQALVSIP---QSISETTGPNFSHLGFGAHDHDLLL--NfnNGG-LPIGERIIVAGRVVDQYG 89
gi 11037226   23 HPPYDTPAYIFTRKRAPSRPLRYIP---QTATELYGPVYGHESVRPEDSDLTR--Q--HDG-EPIGERIRITGRVIDEDG 94
gi 41397188   32 QPLLDYPPYRATILRHPKQPLVAVd---PEAAELWAPCFGRDDVDPLDADLTA--G--HRG-EPIGERVVVAGRVVDEAG 103
gi 29605347   32 HPPRDYAPYRSSVLRHPKQPLVAVHggdPETVELAGPVFGVTDITEIDNDLTR--Q--HRG-EPIGERMTVSGRLLDRDG 106
gi 41326581   13 YSPLHFPEYRTTIKRNPSNDLIMVP---SRLGESTGPVFGDRDLGDIDNDMTK--V--NGG-EAIGQRIFVHGRVLGFDG 84
gi 2935024    15 NAPLLFPEYKTTRLRSPKNDLILVP---QRLGEITGPVFGNADIAKGENDMTH--A--NGG-EAQGQRIIVHGRVLDSAG 86
gi 7649288    13 HPPALTPLYKTSVARSPRFAPIGAA---TSLSEETGPVFGHDLLGPKDNDLITnfA--APGeMAIGPRIVVQGTVRDEFG 87
gi 38490069   14 HPPALTPDYKTSVARSPRNALISLQ---QSVSEITGPVFGHNDIDPIDNDLIHnyA--KAGeSAIGERIIVHGRVLDENG 88
gi 499396282  28 HPLPLSPEYKSSIKRAPNKPLIPMR---HTLSELTGPVYGHETVREGDNDLTT--Q--HTG-EPIGERIIVHGHVLDEDG 99
gi 14026765   24 HPPALTPGYKSSVLRSPQKALLSFD---NSLSEIAGPVFGHAMLGELDADLIHnfA--RPGeSAIGERIIVHGRVLDERG 98
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2PCD_M        90 KPVPNTLVEMWQANAGGRYRHKNDRYLAPLDPNFGGVGRCLTDSDGYYSFRTIKPGPYPWRNGPNDWRPAHIHFGISGPS 169
gi 11037226   95 RGVPNALLEIWQANAAGRYIHKLDQHLAPLDPNFSGAGRTVTGSDGSYSFITIIPGAYPVVGLHNVWRPRHIHISLFGPS 174
gi 41397188  104 RPVAGQLVEIWQANAAGRYRHQRDRHSAPLDPNFTGAGRCLTGPDGWYRFLTIKPGPYPWRNHHNAWRPAHIHFSVFGTA 183
gi 29605347  107 RPVRGQLVEVWQANAAGRYAHLREQHPAPLDPNFTGVGRTLTDDQGRYTFTTIKPGPYPWGNHTNAWRPAHIHFSVFGTA 186
gi 41326581   85 KPVPHTLVEAWQANAAGRYRHKNDSWPAPLDPHFNGVARTLTDKDGQYHFWTVMPGNYPWGNHHNAWRPAHIHFSLYGRQ 164
gi 2935024    87 KPIPDTLIEVWQANAGGRYRHKMDSWPAPLDPHFNGVARCLTDKQGHYEFTTIKPGAYPWGNHHNAWRPAHIHFSLFGQA 166
gi 7649288    88 RPVPHTLVEVWQANAGGRYRHKKEGYLAPLDPNFGGCGRCITDENGFYEFRTVKPGPYPWPNGPDDWRPAHIHVSVFGHS 167
gi 38490069   89 RPVAGTLVEAWQANAGGRYRHKKDTYLAPIDPNFGGCGRTITDENGYYFFRTVKPGAYPWRNWVNNWRPAHIHMSIFGTS 168
gi 499396282 100 RGVPNSLVEIWQANSCGRYVHVRDQHPAPLDPNFTGAGRTQSDASGYYRFVTIKPGAYPWGNHHNAWRPAHIHLSVFGHS 179
gi 14026765   99 VGVPGVLIEFWQANAGGRYRHKKDGYLAPLDPNFGGCGRTITGEDGGYAFRTVKPGPYPWPNGPNDWRPAHIHFSVFGHG 178
                        170       180       190       200       210       220
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*...
2PCD_M       170 IATKLITQLYFEGDPLIPMCPIVKSIANPEAVQqLIAKLDMNNANPMDCLAYRFDIVLRGQRKTHFEN 237
gi 11037226  175 FLSRLVTQLYFEGDPLLRYDSIYNAAPDFSKRG-MVASLDLEATQSEWGLTYRFDIVLRGRNGNYFEE 241
gi 41397188  184 FTQRLITQMYFPGDPMFELDPIFQSILDPAARRrLIAHYDHDLTQPEYATGYRWDIVLAGGGRTPTGA 251
gi 29605347  187 FTQRLVTQMYFPSDPLFAYDPILRSVTDAAARNrLIATYQHDLSAPGFSLGYAWDIVLDGPSATWIEE 254
gi 41326581  165 FTERLVTQMYFPNDPLFFQDPIYNAVP-KGARErMIATFDYDETRENFALGYKFDIVLRGRNATPFE- 230
gi 2935024   167 FTQRLVTQMYFPDDPFFFQDPIYNSVP-EAARErMISTFDYDHTRDNWAVGFKFDIVLRGQDATPFED 233
gi 7649288   168 FAQRLITQMYFEGDPMIWQCPIVGTIPSREAIEtLVARLDRAGSIPMDALCYQFDITLRGRRQTMFEN 235
gi 38490069  169 FSQRLITQCYFEGDPLIAKCPIVKTIPTQDGIDsLVAALDLNATIPLDSIAYKFDIVLRGRRSTLFEN 236
gi 499396282 180 FVTRLVTQMYFPADPLFPFDPIFNSVPDEKARArMVSSFDLENTQPEWALCYRFDIVLRGKNATPMES 247
gi 14026765  179 FAQRLITQMYFEGDPLIWKCPIVRGIADKAAIEaLTAILDTQATIPMDALAYKFDIVLRGRRSSLFEN 246
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap