Conserved Protein Domain Family
decarb_PcaC

?
TIGR02425: decarb_PcaC 
4-carboxymuconolactone decarboxylase
Members of this family are 4-carboxymuconolactone decarboxylase, which catalyzes the third step in the catabolism of protocatechuate (and therefore the fourth step in the catabolism of para-hydroxybenzoate, of 3-hydroxybenzoate, of vanillate, etc.). Most members of this family are encoded within protocatechuate catabolism operons. This protein is sometimes found as a fusion protein with other enzymes of the pathway, as in Rhodococcus opacus, Streptomyces avermitilis, and Caulobacter crescentus. [Energy metabolism, Other]
Statistics
?
PSSM-Id: 131478
View PSSM: TIGR02425
Aligned: 7 rows
Threshold Bit Score: 189.576
Threshold Setting Gi: 38490091
Created: 8-Oct-2014
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5091484     3 EKQRYDAGMQVRRAVLGDAHVDRSLEKLND-FNGEFQEMITRHAWGDIWTRPGLPRHTRSLITIAMLIGMNRNDELKLHL 81
gi 21106449    3 EDERYQAGMRERRRVLGDAHVDRALAARSD-FTEEFQDLITRYAWGGIWTRDGLPAHTRSLITLSMMIALGHDEEFKLHV 81
gi 14026764    7 NAARYRTGLAVRRAVLGDRHVDRAEVAATD-FDQPFQALITEAAWGTVWARPGLSKRERSIVTLALLAALGHDEEVALHV 85
gi 38490091    2 TQDRYDRGMQVRRRVLGDAHVDRAEAAKTA-LDQPFQELITEAAWGTVWASDRISLRERSMLTLALLAATGNFAEIPMHI 80
gi 2935027   265 RRAAHAQGMTVRRSVLGDAHVDRSVAGTTD-FTAPFQDFITRTAWGDIWSRPGLDHELRRLLTIAVLTAVGNEHELDMHI 343
gi 499280883   7 KNERFEQGMKTRRAVLGDAHVNRAQTMTSD-FDQPFQQLITEGAWGTVWSGNHFTKRERSIVTIALLAALGQDEELAMHV 85
gi 499190307  35 PQEMFEQGLEKRRAVMGAEFVDRAFAGGEDaFGADFQRFMTEYAWGAVWGRGGLTDRERHMVTIGILAALGREKELAGHL 114
                         90       100       110       120
                 ....*....|....*....|....*....|....*....|....
gi 5091484    82 RAAANNGVTRDEIKEVLMQSAIYCGIPAANATFHMAESVWDELG 125
gi 21106449   82 RAARNNGVTPAQIKEVLLQAAIYCGVPAANHAFALARPILEEQA 125
gi 14026764   86 RATANTGATRDDICEAFLHVAIYAGVPAANRAFRIAKDVFSEMD 129
gi 38490091   81 RATARTGASQADVQEAFQHVAVYAGVPRANQALKLAKETYAAMA 124
gi 2935027   344 RAALRAGVDADTIGEVLLHTAVYAGVPNSNLGFALGKQALADLS 387
gi 499280883  86 RATVNTGATEADIREALLHVAIYAGVPAANHAFKIAKLALVSMK 129
gi 499190307 115 RATANTGVSERDLSDVLHQVAIYAGVPAALSAVNATKEMLAKRH 158
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap