2IA2


Conserved Protein Domain Family
pcaR_pcaU

?
TIGR02431: pcaR_pcaU 
Click on image for an interactive view with Cn3D
beta-ketoadipate pathway transcriptional regulators, PcaR/PcaU/PobR family
Member of this family are IclR-type transcriptional regulators with similar DNA binding sites, able to bind at least three different metabolites related to protocatechuate metabolism. Beta-ketoadipate is the inducer for PcaR, p-hydroxybenzoate for PobR, and protocatechuate for PcaU. [Regulatory functions, DNA interactions]
Statistics
?
PSSM-Id: 131484
View PSSM: TIGR02431
Aligned: 16 rows
Threshold Bit Score: 336.925
Threshold Setting Gi: 29607355
Created: 8-Oct-2014
Updated: 23-Jan-2015
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2IA2_A        13 SPDYVQSLARGLAVIRCFDHRNQRRTLSDVARATDLTRATARRFLLTLVELGYVATDGSAFWLTPRVLELGYSYLSSLSL 92
gi 6174891    27 HEDFVAGISKGMAILDSFGTDRHRLNITMAAEKTGMTRAAARRHLLTLEYLGYLESDGHYFYLTPKILKFSGSYLGGAQL 106
gi 24984183    8 PRDLIAGLQKGLALMQLFSAEQPRLSVPQAARLSGLTSSAVRRFLLTLVHEGFAETDSRDYWLTPKALRIGQAYVDSAQL 87
gi 6093656    41 DPDFMTSLARGLAVIQAFQERKRHLTIAQISHRTEIPRAAVRRCLHTLIKLGYATSDGRTYSLLPKVLTLGHAYLSSTPL 120
gi 29607355  316 GREFVESLARGLTVITSFGEGRSALTLTEVARATGLARATARRALITLEHLGYVTAQSGVFRLTPRVLGLGFPALSRTTL 395
gi 38198156   10 DRDYIQSIERGFAVLTAFDEKNPNPSLADLAAETGLSRPAVRRILLTLQKLGYVTGNNSRWSLTPRVLSIGQHFSASHAL 89
gi 14024292    7 SRDHVGSLERGLAVMEILARHPSGMTLTEMAEQAGLTRAGARRFLLTLVATGYATQDGRMFSLSPRLLAVARTWLGGGSL 86
gi 39647905   15 SAEFIESLSRGLRVIEAFGAEKRPMTLSDVAKACGLPRATARRILLTLQSAGYVSSDDRLFALTPRVLGLASAYLASNQI 94
gi 490819825   3 ETDFVGGFAKGLRVIEAFGEDRPRLSIADVSKITGLDRATARRCLLTLAELGYAEYDGKFFMLLPRILRLGHAYLSGTPL 82
gi 6093755    19 TEDYIAGLAKGLALLEAFGIDRQRLNVTQVAERTGISRTAARRYLKTLKFLGYLDTDEHYFWLTHRVLRFSSSYLSSAHL 98
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2IA2_A        93 PEVAQPHLEKLSHKVHESSSVSILDGADIVYVARVPVSR-IXT-----VGITIGTRLPAYATSXGRVLLAGLPDDELDAY 166
gi 6174891   107 PKISQPLLNLLTTQTSLIYSVMVLDGYEAITIARSAAHQ-QTDrv-npYGLHLGNRLPAHATSAGKILLAYLDDHAQQEW 184
gi 24984183   88 PRMLRPIVEQVARQTQEHVSVGTRDGDEIIHLVRSRYSH-VAS-----LSIRPGSRVPMYCTASGRIWLAWLDEGERDEY 161
gi 6093656   121 AISAQPYLDRISDQLHEAANMATLEGDDILYIARSATVErLIS-----VDLSVGGRLPAYCTSMGRILLAAMDDTSLREY 195
gi 29607355  396 PDVAAPHLAALSRRVHESASLAVLAGDEIRYTARFTTSR-VMS-----VNITVGTRLPAYATSLGRVMLADLPEPHLPDP 469
gi 38198156   90 TEAALPRLLEIAEHTHESASLGVLDGVDVVYAARVPVRR-IMS-----INVSVGTRVPAYATSMGRALLAWAPTEIVDNV 163
gi 14024292   87 WSFAAPIMRTVAAQLNEACSAAILSGQDVVYVARIPGRR-ILS-----VSLDVGTRLPAYCTSMGRMLLAGLAPEELDEF 160
gi 39647905   95 SAVLQPLMDRVSASAKEVCSLAILDGDDAVFVARASPAR-VFS-----AGIDLGYRLPLFCTSVGRVLLSRLDNDELTAT 168
gi 490819825  83 PTIIQPHLDRLSQSVGESASASVLDGAEIVYIARASQMR-VIS-----INLMAGSRLPAYCASMGRVLLAWLDESEARTI 156
gi 6093755    99 PKVAQSFLNLLCAQTSLTFSIVVLDEHEVVPVARSYLPQ-QDNlrvspYGMHLGNRLPAHATSTGKVLLSVLDREVQIEW 177
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2IA2_A       167 LEKLDIQRLTERTITARDELKAAILAVRADGICVLDQELEAGLRSXAAPIRGASGLTVAAVNISTPAARYSLEDLHSDLI 246
gi 6174891   185 LNQYPLQRLTKYTYTNNIDFLRLLSEIKEQGWCYSSEEHELGVHALAVPIYGQQSRVVAALNIVSPTMRTTKEYLIQHIL 264
gi 24984183  162 FARHPLRALTPYTLTDRAQLDAELQRVKGQGFCIVDQEYEIGMRVLGVPLLGRAGQLKATLTITTHASRLSIDEIRLRYL 241
gi 6093656   196 LGRADLKARTSRTLHDPESLFACIQQVRAQGWCVVDQELEQGLRSIAVPIYDASGQVLAALNVSTHVGRVTRSELEQRFL 275
gi 29607355  470 SDLVAP---TPRTVTDPEELRAVLDRVRRDGYALVDGELEEGLRSIAVPVRERGGRVVAAVNVALHSSRRTPEECVEEVL 546
gi 38198156  164 IANSTFDALTPTTITDEGAFHTALRVVREQGYALTSEELEDGLISLAAPVRDAGGSVVGVAACSTSAGRTTPEAFRTDVA 243
gi 14024292  161 LHQATIERRTPKTITDIGLLAEAIGKARADGFAIVDEELELGLRSIAVPIRDRAGNTVAAINVSTQSARFSVAEMEREIL 240
gi 39647905  169 INAMTLTKQTEDTITDKQTVIATIIADRTKGYSLVDREAEPGFRSVAVPIRRYDGTIVAAANIGAHVDRITTGEMIDRFL 248
gi 490819825 157 LEQTELRARTPFTQKDPEKLMEELRRIRAQGFAVNDQELELGLRSIAVPVFNHRGAVVAALNIGAPVAHVEVSDLVGRIL 236
gi 6093755   178 IEKYGLKRLTPYTITDEHTFLETLDAVRQSDYCLSTEEHELGLIAIAVPVLNAQGLTIAALNCMSQTNRVQPQYLIDQVL 257
                        250
                 ....*....|....
2IA2_A       247 PSLRVTATDIEQDL 260
gi 6174891   265 PLLQETARELRNIL 278
gi 24984183  242 PTLYEAQALLRPVL 255
gi 6093656   276 PILLAASRDLCHQL 289
gi 29607355  547 PELLATASRIEADL 560
gi 38198156  244 PFLVEKANQLSADM 257
gi 14024292  241 PALLEARQRIEDFF 254
gi 39647905  249 PLLQTMAEEARPLM 262
gi 490819825 237 PEMLKIQSELRSML 250
gi 6093755   258 PLLRNTANELRNLV 271
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap