2NPN


Conserved Protein Domain Family
CobF

?
TIGR02434: CobF 
Click on image for an interactive view with Cn3D
precorrin-6A synthase (deacetylating)
In the aerobic cobalamin biosythesis pathway, four enzymes are involved in the conversion of precorrin-3A to precorrin-6A. The first of the four steps is carried out by EC 1.14.13.83, precorrin-3B synthase (CobG), yielding precorrin-3B as the product. This is followed by three methylation reactions, which introduce a methyl group at C-17 (CobJ; EC 2.1.1.131), C-11 (CobM; EC 2.1.1.133) and C-1 (CobF; EC 2.1.1.152) of the macrocycle, giving rise to precorrin-4, precorrin-5 and precorrin-6A, respectively. This model identifies CobF in High GC gram positive, alphaproteobacteria and pseudomonas-related species.
Statistics
?
PSSM-Id: 131487
View PSSM: TIGR02434
Aligned: 9 rows
Threshold Bit Score: 371.72
Threshold Setting Gi: 50840973
Created: 8-Oct-2014
Updated: 23-Jan-2015
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2NPN_A         3 RTIYVIGIGTGSPEFLTLQAISGLRHAQAIVALDKGEQKSDLLALRQKIVD-----THAPGTPIYAVTDPER--DRNPDN 75
gi 7649557     2 RTIHVIGIGAGDPEQLTLQAVRALRGTDVFFVLDKGEAKSDLVRLRRDMLEa---hVPEGTYRVAEARDPERdrSAGGAA 78
gi 24985441    2 KDLLLIGIGAGDPRQVTYEAVDALRSASVFFVLDKGDDKDELVRLRKAILQr---yRPEGGYRLVPVVDPLR--DAQAQD 76
gi 116837      7 RKILIIGIGSGNPEHMTVQAINALNCADVLFIPTKGAKKTELAEVRRDICAr---yVTRKDSRTVEFAVPVR--RTEGVS 81
gi 39649017    2 RKILLIGIGPGGPNYLTFQAVEALNRATVFFIPDKGDEKAELRLAREQICEr---fITAPGYRFVTIDIPKR--EAQPQD 76
gi 27351534    2 LALSLIGIGCGDPEQLTHAATRAINAADLVLIPRKGSAKSDLADLRRTICAd---vLTSDNTRIAEFDLPVR--DAGEAD 76
gi 38199679    2 RTIYVIGIGTGSPEFLTLQAISGLRHAQAIVALDKGEQKSDLLALRQKIVD-----THAPGTPIYAVTDPER--DRNPDN 74
gi 505445585   3 RHIHVIGIGAGDPDYLTVQAIEALNDTQVFFAMDKGEQKSDLVALRREICSr---fIRQPGYRFVELRDPKR--SDRAD- 76
gi 50840973    3 RRLDLIGIGPGNPDWLTLAAVDAIQHLDVLFVVLKEHDVDDLVEFRREVLRrhrpdADFDGLHIVELQDPPRp-WKTAEN 81
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2NPN_A        76 YEEEVRRWHAERAHLLASTIRERTPDDGAVAFLVWGDPSLYDSTLRIIEHXRN----LEDLHADVKVIPGITAVQVLTAE 151
gi 7649557    79 YSPAVGDWRSARAGIYERLIAEELGEDETGAFLVWGDPALYDSTLGILEEILE----RGSVAFEYDVVPGISSVSSLVAR 154
gi 24985441   77 YLGAVQNWHRQRAALYARLIEEEIGDGETGAFLLWGEPTLYDSTLRILDLVRE----QGVT-LRLQVIPGISSVQALAAR 151
gi 116837     82 YDGSVDDWHAQIAGIYEALLSKELGEEGTGAFLVWGDPMLYDSTIRIVERVKA----RGEVAFAYDVIPGITSLQALCAS 157
gi 39649017   77 YRATVDDWHARIADRFAQAMTEQLPEGSCGAFLVWGDPSLYDSTIRILDRLR-----LRGMEIDYEIIPGITAVQALTAR 151
gi 27351534   77 YRKGVDDWHDAVAAKWSQTITSHLEGDGRVALLIWGDPSLYDSSLRIAGRLDP-------LP-EIEVIPGITSIQALCAA 148
gi 38199679   75 YEEEVRRWHAERAHLLASTIRERTPDDGAVAFLVWGDPSLYDSTLRIIEHMRN----LEDLHADVKVIPGITAVQVLTAE 150
gi 505445585  77 YRDAVAEWHAARAQIWADAIAAELGPHGVGGFLAWGDPSLYDSTLRILDTVAG----HVEFTFDV--IPGITAVQALTAR 150
gi 50840973   82 YKAAVAKWRRQRLDQWTHAVADNLADGERGGFLVWGDPGLFESTLAIVKKLIAavdaDGGVPIELNVIPGISSSLSLASR 161
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2NPN_A       152 HGILINRIGEAIHITTGRNLPETsAKDR-RNCVVXLDGKTAWQDVATEHTYXWWGAFLGTEQQVLRKGYVHEIGAQVAEL 230
gi 7649557   155 HRTGLNRVARPVQITTGRRLAEG-FPEDaDDVVVMLDAHQAFRRYADQDIDIYWGAYLGTPDEILDSGPIAEAAPRIERL 233
gi 24985441  152 HQVPLNRIGEPLTVLPGRRLAEQg--Av-DNVVVMLDGQCAFAGLDDPALTIYWGAYLGTEDEVLIAGPLQAVKAQILEV 228
gi 116837    158 HRIPLNLVGKPVEITTGRRLHES-FPEKsQTSVVMLDGEQAFQRVEDPEAEIYWGAYLGTRDEIVISGRVAEVKDRILET 236
gi 39649017  152 HGIALNGIGEPVTVTTGRKLAATgRWSG-ETMVVMLDGEETFAKIDAEGAEIFWAANLGMDDEVLVTGKLPEIAPEIQRI 230
gi 27351534  149 HALPLNDIGEPFLVTTGRRLREGgWPVSaDTVVVMLDGGTAFQSLDPVGLQIWWGAYLGMPDQIIMSGALAEVGPRIAAL 228
gi 38199679  151 HGILINRIGEAIHITTGRNLPETsAKDR-RNCVVMLDGKTAWQDVATEHTYMWWGAFLGTEQQVLRKGYVHEIGAQVAEL 229
gi 505445585 151 HRIPLNEVGEPVLITTGRQLRAHgISG---SAVVMLDADCSFQRCAPETR-IWWGAYLGTADELLVAGTVGEVGPRIAAL 226
gi 50840973  162 HQIPLNRQGRALQISPARLLANG-MPEGvDDVIVMLDGRQTFSLIDPTDIDIYWAAYIGTPDEILISGDLAEVREEIRSA 240
                        250
                 ....*....|....*....
2NPN_A       231 KQQLRTEHGWIXDTYLLRE 249
gi 7649557   234 RAEARERKGWIMDTYLLRR 252
gi 24985441  229 RERERARKGWIMDTYLLRR 247
gi 116837    237 RAAARAKMGWIMDIYLLRK 255
gi 39649017  231 RRQVRAAKGWVMDIYLLRK 249
gi 27351534  229 RQEARERHGWIMDCYILKR 247
gi 38199679  230 KQQLRTEHGWIMDTYLLRE 248
gi 505445585 227 RAQARARHGWIMDTYLLRP 245
gi 50840973  241 RADAEKRLGWVFDTYLLRR 259
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap