Conserved Protein Domain Family
FadJ

?
TIGR02440: FadJ 
fatty oxidation complex, alpha subunit FadJ
Members represent alpha subunit of multifunctional enzyme complex of the fatty acid degradation cycle. Plays a minor role in aerobic beta-oxidation of fatty acids. FadJI complex is necessary for anaerobic growth on short-chain acids with nitrate as an electron acceptor. Activities include: enoyl-CoA hydratase (EC 4.2.1.17),3-hydroxyacyl-CoA dehydrogenase (EC 1.1.1.35), 3-hydroxybutyryl-CoA epimerase (EC 5.1.2.3). A representative is E. coli FadJ (aka YfcX) (SP:P77399). This model excludes the FadB of TIGR02437 equivalog model. [Fatty acid and phospholipid metabolism, Degradation]
Statistics
?
PSSM-Id: 131493
View PSSM: TIGR02440
Aligned: 4 rows
Threshold Bit Score: 1284.76
Threshold Setting Gi: 24349225
Created: 8-Oct-2014
Updated: 11-Oct-2014
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 3334437     6 AFTLNVRLDNIAVITIDVPGEKMNTLKAEFASQVRAIIKQLRENKELRGVVFVSAKPDNFIAGADINMIGNCKTAQEAEA 85
gi 410519869   4 TFNLTRREDGIAILTMDVPGETMNTLKAEFGPEISEILSEIKRDSSIRGLVLISGKKDSFVAGADISMLDACQTAGDAKA 83
gi 46912583   13 AFSLTFGDNGVAWLKIDVPNERMNTLQSAFVDQVTDVLAQLKDKKDIKGMVVYSGKPDNFIAGADIRMLAACQTADEAQQ 92
gi 488193451  41 AFTLNVRPDNIGIITIDVVGDKVNTLKAEFADQIATILQQAHALPKLQGLVIVSGKPDSFIAGADITMIAACRTAHDARV 120
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 3334437    86 LARQGQQLMAEIHALPIQVIAAIHGACLGGGLELALACHGRVCTDDPKTVLGLPEVQLGLLPGSGGTQRLPRLIGVSTAL 165
gi 410519869  84 LSQQGHVVFNELEALNIPVVAAIHGACLGGGLELALACHQRVCSDDGKTMLGVPEVQLGLLPGGGGTQRLPRLVGITTAL 163
gi 46912583   93 LAAKGQELFGQLEALPFHVVAAIHGPCLGGGLELALACHSRVCSDDDKTRLGLPEVQLGLLPGSGGTQRLPRLIGVANAL 172
gi 488193451 121 LAQKGQSILAQIAAFPVPVVAAIHGACLGGGLELALACHSRICSLDDKTVLGLPEVQLGLLPGSGGTQRLPRLVGVSKAL 200
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 3334437   166 EMILTGKQLRAKQALKLGLVDDVVPHSILLEAAVELAKKERPSSRP--LPVRERILAG-PLGRALLFKMVGKKTEHKTQG 242
gi 410519869 164 DMMLTGKQIRPKQALKMGLVNDVVPQTILLQTAVEMALAGKQIAKPvkKSLVNQLLEGtGFGRNIIFDQAAKQVAKKTQG 243
gi 46912583  173 DMILTGKQLRAKKAKNLGLVEEAVPLSILLDIAEKQALKGKPKRK---GSFQEWAMGGnALGRSVVFDQAAKKTHEKTRG 249
gi 488193451 201 DMILTGKQIRPRQALKMGLVDDVVPRDILLDVAIQRAKAGWLNRRA--LPWQERLLSG-PLGKALLFRIVRKKTLAKTRG 277
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 3334437   243 NYPATERILEVVETGLAQGTSSGYDAEARAFGELAMTPQSQALRSIFFASTDVKKDPGSD-APPAPLNSVGILGGGLMGG 321
gi 410519869 244 NYPAPAKIIDCVRQGIAKGMQKGLEVEASHFAELVVSKESEALRSIFFATTEMKKETGAEgATPRKVKKAVILGGGLMGG 323
gi 46912583  250 NYPAADAILDVIKYGLQHGMKKGLDQEAKRFGELVMTSESAALRSIFFATTAMKKESGSD-ALPATIKKVGVLGGGLMGG 328
gi 488193451 278 HYPAAERIIDVVRKGLDQGGPSGYEAEARAFGELAMSPQSAALRSLFFATTSLKKETGSA-ATARAIHRVGVLGGGLMGG 356
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 3334437   322 GIAYVTACKAGIPVRIKDINPQGINHALKYSWDQLEGKVRRRHLKASERDKQLALISGTTDYRGFAHRDLIIEAVFENLE 401
gi 410519869 324 GIASVTTTKAKIPARVKDINEKGLSNALSYAYKLLDKGVKRRHMTPAARDNLMALMTTTTEYKGVKDADIVVEAVFEDLA 403
gi 46912583  329 GISHVTATKAGYPVRIKDISNDGIKNALVYNFKLLDKQRKRRIISKAELQNKMFSITGGTTFTGFTNVDVVIEAVFEDIN 408
gi 488193451 357 GIANVTATRAGLPVRIKDINPQGINQALKYTWDALGKRVRSKRMRPTEQQRQMMLISGSTDYRGFERVDIVVEAVFEDLS 436
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 3334437   402 LKQQMVAEVEQNCAAHTIFASNTSSLPIGDIAAHATRPEQVIGLHFFSPVEKMPLVEIIPHAGT------SAQTIATTVK 475
gi 410519869 404 LKHQMVKDIERECGEHTIFASNTSSLPIGQIAQAASRPENVIGLHYFSPVEKMPLVEVIAHAKT------SPETIATTVA 477
gi 46912583  409 LKHQMVKDIEQQTSDYTIFASNTSSLPIHQIAAAAERPENVVGLHYFSPVEKMPLVEVIPHQGTengsatSEQTIATVVA 488
gi 488193451 437 LKQQMVADIERFGAAHTIFASNTSSLPISQIAALAQRPEQVIGLHYFSPVDKMPLVEVIPHEKT------SEETIATTVA 510
                        490       500       510       520       530       540       550       560
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 3334437   476 LAKKQGKTPIVVRDKAGFYVNRILAPYINEAIRMLTQGERVEHIDAALVKFGFPVGPIQLLDEVGIDTGTKIIPVLEAAY 555
gi 410519869 478 FARKQGKTPIVVQDGAGFYVNRILALYMNEAAQLLLEGQSVEHLDKALVKFGFPVGPITLLDEVGIDVGAKISPILEKEL 557
gi 46912583  489 LAKKQGKTPIVVADKAGFYVNRILAPYMNEAAAVLLSGEPIEHIDRSLLDFGFPVGPITLLDEVGVDIGAKISPILLAEL 568
gi 488193451 511 LARKQGKTAIVVADRAGFYVNRILAPYINEAARCLLDGEPIESVDNALVDFGFPVGPMMLLDEVGIDVATKIMPILVEQL 590
                        570       580       590       600       610       620       630       640
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 3334437   556 GERFSAPAnVVSSILNDDRKGRKNGRGFYLYGQKGRk------------------sK---KQVDPAIYPLIGTQGQGRIS 614
gi 410519869 558 GERFKAPA-AFDKLLSDDRKGRKNGKGFYQYGAASK--------------------K---KAVDETVYGVLGIKPGVDKE 613
gi 46912583  569 GERFKAPD-VFDLLLSDDRKGRKSGKGFYLY--NTK--------------------K---KEVDKSVYKLLSLEPEQKAA 622
gi 488193451 591 GPRFAAPP-SFDVILKDGRKGRKNGRGFYLYSNPTKnssptkngnspakrnsfkwrKnkvKPVDASIYTLLGVTPKAHLG 669
                        650       660       670       680       690       700       710       720
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 3334437   615 APQVAERCVMLMLNEAVRCVDEQVIRSVRDGDIGAVFGIGFPPFLGGPFRYIDSLGAGEVVAIMQRLATQYGSRFTPCER 694
gi 410519869 614 MSAVAERCVVQMLNEAVRCLDAGIIASPRDGDIGAIFGIGFPPFLGGPFHYIDTLGADNLVKILERYQTQYGDRFEPCQR 693
gi 46912583  623 GQDIALRCTLMMLNEAARCLDEGVIKSARDGDIGAIFGIGFPPFLGGPFRYMDTLGAKRVVEMLKDHTDKYGGRFTPCDK 702
gi 488193451 670 AGVITQRCTMLMLNEAVRCLDESIIRNPRDGDIGAVFGIGFPPFLGGPFRYLDSLGADKVVQALRLLVQQYGERFEPCQR 749
                        730
                 ....*....|..
gi 3334437   695 LVEMGARGESFW 706
gi 410519869 694 LKAMAAEKARFF 705
gi 46912583  703 LVAMANEEQSFY 714
gi 488193451 750 LVTMAEQQQQFY 761
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap