Conserved Protein Domain Family
TreS_stutzeri

?
TIGR02455: TreS_stutzeri 
trehalose synthase, Pseudomonas stutzeri type
Trehalose synthase catalyzes a one-step conversion of maltose to trehalose. This is an alternative to the OtsAB and TreYZ pathways. This family includes a characterized example from Pseudomonas stutzeri plus very closely related sequences from other Pseudomonads. Cutoff scores are set to find a more distantly related sequence from Desulfovibrio vulgaris, likely to be functionally equivalent, between trusted and noise limits. [Energy metabolism, Biosynthesis and degradation of polysaccharides, Cellular processes, Adaptations to atypical conditions]
Statistics
?
PSSM-Id: 131508
View PSSM: TIGR02455
Aligned: 2 rows
Threshold Bit Score: 1494.47
Threshold Setting Gi: 24984521
Created: 8-Oct-2014
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6724082    1 MSIPDNTYIEWLVSQSMLHAARERSRHYAGQARLWQRPYAQARPRDASAIASVWFTAYPAAIITPEGGTVLEALGDDRLW 80
gi 24984521   1 MTQPDPSYVKWLEDRAMLKASQDRASLYSGQSRLWQQPYAEAQPRRATEIASVWLTVYPDAIIAPEGCSVLGALAHEALW 80
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6724082   81 SALSELGVQGIHNGPMKRSGGLRGREFTPTIDGNFDRISFDIDPSLGTEEQMLQLSRVAAAHNAIVIDDIVPAHTGKGAD 160
gi 24984521  81 KRLSEIGVQGLHTGPIKLSGGIRGRELTPSVDGNFDRISFDIDPLYGSEQELIQMSRMAAAHNAVTIDDLIPSHTGKGAD 160
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6724082  161 FRLAEMAYGDYPGLYHMVEIREEDWELLPEVPAGRDSVNLLPPVVDRLKEKHYIVGQLQRVIFFEPGIKDTDWSVTGEVT 240
gi 24984521 161 FRLAELAHGPYPGLYHMVEIREEDWALLPEVPAGRDAVNLLPAQCDELKARHYIVGQLQRVIFFEPGVKETDWSATPPIT 240
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6724082  241 GVDGKVRRWVYLHYFKEGQPSLNWLDPTFAAQQLIIGDALHAIDVTGARVLRLDANGFLGVERRAEGTAWSEGHPLSVTG 320
gi 24984521 241 GVDGKTRRWVYLHYFKEGQPSLNWLDPTFAAQQMIIGDALHALDCLGARGLRLDANGFLGVETRASGTAWSESHPLSLVG 320
                       330       340       350       360       370       380       390       400
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6724082  321 NQLLAGAIRKAGGFSFQELNLTIDDIAAMSHGGADLSYDFITRPAYHHALLTGDTEFLRMMLREVHAFGIDPASLIHALQ 400
gi 24984521 321 NQLIGGMIRKAGGFSFQELNLTLDDIAQMSKGGADLSYDFITRPAYQHALLTGDTEFLRLMLKEMHAFGIDPASLIHALQ 400
                       410       420       430       440       450       460       470       480
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6724082  401 NHDELTLELVHFWTLHAYDHYHYKGQTLPGGHLREHIREEMYERLTGEHAPYNLKFVTNGVSCTTASVIAAALNIRDLDA 480
gi 24984521 401 NHDELTVELVHFWTLHAHDMYLYKGQTLPGSILREHIREEIYERLSGEHAPYNLRFVTNGIACTTASLIAAALGIRDLEQ 480
                       490       500       510       520       530       540       550       560
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6724082  481 IGPAEVEQIQRLHILLVMFNAMQPGVFALSGWDLVGALPLAPEQVEHLMGDGDTRWINRGGYDLADLAPEASVSAEGLPK 560
gi 24984521 481 IGVADIELIKKVHLLLVMYNAMQPGVVALSGWDLVGALPLPAEAVAERMLDGDTRWIHRGGYDLAGLDPQAEASVRGMPR 560
                       570       580       590       600       610       620       630       640
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6724082  561 ARSLYGSLAEQLQRPGSFACQLKRILSVRQAYDIAASKQILIPDVQAPGLLVMVHELPAGKGVQLTALNFSAEPVSETIC 640
gi 24984521 561 ARALYGSLDRQLDESDSFACKVKKLLAVRQAYGIATSRQVLVPEVSSPGLLVMVHELPAGRGIQITALNFGQDAIAEELL 640
                       650       660       670       680
                ....*....|....*....|....*....|....*....|....*...
gi 6724082  641 LPGVAPGPVVDIIHESVEGDLTDNCELQINLDPYEGLALRVVSAAPPV 688
gi 24984521 641 LTGFTPGPVVDMINETVEGDLTEDGRLMVNLDPYEALCLRIVNSSGHV 688
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap