Conserved Protein Domain Family
sucr_syn_bact_C

?
TIGR02471: sucr_syn_bact_C 
sucrose-phosphate synthase, sucrose phosphatase-like domain, bacterial
Sucrose phosphate synthase (SPS) and sucrose phosphate phosphatase (SPP) are the last two enzymes of sucrose biosynthesis. In cyanobacteria and plants, the C-terminal region of most or all versions of SPS has a domain homologous to the known SPP. This domain may serve a binding or regulatory rather than catalytic function. Sequences in this family are bacterial C-terminal regions found in all but two of the putative bacterial sucrose phosphate synthases described by TIGR02472.
Statistics
?
PSSM-Id: 131524
View PSSM: TIGR02471
Aligned: 4 rows
Threshold Bit Score: 370.251
Threshold Setting Gi: 16605569
Created: 8-Oct-2014
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 16605569  467 LLLLDLDSSLEEpEAEGLASLREGLEsiGSGDAHGLGVLTGRSVQAAKKRYAELNLPSPRVWISRAGTEIHYGLEDQSDR 546
gi 30180517  476 VIISDIDNTLLG-DEQGLAEFLQWLR--MHAGNISFGIATGRTVESAVRILKKWRVPMPDILITSVGSEINYWPSLRPDK 552
gi 32398248  480 IIMTDLDNTLTG-DDEALADFVDLLN--TAGRDVGFGIDTGRSLDEAMSLITKLNLPRPDVLSAAVGTELYYGEGLTPDL 556
gi 500034339 471 AIITDLDQNLLG-DDTSLSAFVALMR--QYRKQVSFGIATGRNLESALSVMRKHKIPQPDVIMANLGTEVYYAPDLLLDS 547
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 16605569  547 FWQAHIDVDWRRQAVVSALADLKDhLTLQDDQEQGPHKVSYLLKEHGEAILPLVRQRLRQRSQAARPHLRCHWFLDVVPL 626
gi 30180517  553 GWSNHIRHRWRREALAEALKEIPG-LALQAPENQREFKLSYLVTPERMPPLKQLYQHLHKQNLHAKLIYSHEAFLDVLPV 631
gi 32398248  557 SWRKQIKHHWQPKLVHEVLDSIPG-LFLQTEKDQTEFKISYRIDPEDSPSVAQIRKMLRSAGLRVKVVLSLGSFLDIIPL 635
gi 500034339 548 AWKKHINHLWFRHEIVEILSQVPG-LSMQPKGSQSPFKISYYMDPNVAPDLQEINRILHQQEQTVNVIFSRGQFLDILPH 626
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 16605569  627 RASRSEAIRYLSLRWGLPLEQILVVASQQGDAELVRGLTASVVLAE-HDPCLEGLRHQQRVFFANNPHLFGLLDGLNHYR 705
gi 30180517  632 RASKGLAVRYLAYKWGLPLQSFLIAGDSGNDEEMLVGDTLGVVVGN-HSPELESLRDREQIYFAKNTYALGILEGMKHYH 710
gi 32398248  636 RGGSELSLRHLAYRWGFEPERLLVAGDCGNDEGMLKGGTLGVVVGN-YSPELEKLRRLPRIYFAEGNHARGIMEGIEYYD 714
gi 500034339 627 RASKGYALRWVSAQLDIPLENMLVAGGSGADEDMMRGNTQAVVVGNrHDEELSTLAEVDKIYFAQQSYAAGIIEAIDHYD 706

                 .
gi 16605569  706 F 706
gi 30180517  711 F 711
gi 32398248  715 F 715
gi 500034339 707 F 707
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap