Conserved Protein Domain Family
sucr_P_syn_N

?
TIGR02472: sucr_P_syn_N 
sucrose-phosphate synthase, putative, glycosyltransferase domain
This family consists of the N-terminal regions, or in some cases the entirety, of bacterial proteins closely related to plant sucrose-phosphate synthases (SPS). The C-terminal domain (TIGR02471), found with most members of this family, resembles both bona fide plant sucrose-phosphate phosphatases (SPP) and the SPP-like domain of plant SPS. At least two members of this family lack the SPP-like domain, which may have binding or regulatory rather than enzymatic activity by analogy to plant SPS. This enzyme produces sucrose 6-phosphate and UDP from UDP-glucose and D-fructose 6-phosphate, and may be encoded near the gene for fructokinase.
Statistics
?
PSSM-Id: 131525
View PSSM: TIGR02472
Aligned: 6 rows
Threshold Bit Score: 810.88
Threshold Setting Gi: 16605569
Created: 8-Oct-2014
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 22294303    5 LYIVLISIHGLIRGDRLELGRDADTGGQTRYVVELAKTLAAHPRVAQVDLVTRLIPDAKVSPDYAQPIERIGDRARIVRL 84
gi 30180517    7 LYILMMSVHGLVRGHDMELGRDADTGGQITYVVELARALGRNSHIAQIDLLTRQIEDPNISPDYAAEIEELGPNARIVRL 86
gi 32398248    9 LRVTLLSLHGLIRARDCELGRDADTGGQVKYVLELAEELSRREEVESVELVTRQIFDERVGPDYAQVEEIINPKAKIVRV 88
gi 16605569    3 LRLLHLHLHGLFRSHDLELGRDADTGGQALYVLELVRGLAARSEIEQVEVVTRLIHDRRVSTDYANPIEDIAPGAKIIRL 82
gi 16605567    3 LKFLYLHLHGLIRSNNLELGRDSDTGGQTQYVLELVKSLANTSEVDQVDIVTRLIKDSKIDSSYSKKQEFIAPGARILRF 82
gi 500034339   8 LYLILISPHGLIRGENLELGRDADTGGQTKYVVELARALAQRPEVGRVDLLTRRVVDAQLSSDYAEPVERLSDKARIVRI 87
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 22294303   85 ACGPRRYLRKEVLWPYLDVFADELLRYLRQSGRMPDVIHSHYADAGYVGCRVAGWLGVPLVHTGHSLGRVKRQRLLAQGS 164
gi 30180517   87 PCGPRKYLRKELLWPHLDQMVDRCLHYLRQQGRLPDLIHTHYADAGYVGQHLSNLLGIPQIHTGHSLGRPKRARLLASGR 166
gi 32398248   89 PFGPKRYLRKEGLWPYLETFIDQMLGHYRRVG-LPDLIHGHYADAGYAGAQLARLLHVPYVFTGHSLGRVKRQRLIAASQ 167
gi 16605569   83 PFGPRRYLRKELFWPYLDDLADQTVSHLQQQEHLPDWIHAHYADAGYVGALVSRRLGVPLVFTGHSLGREKLRRLLGVGG 162
gi 16605567   83 QFGPNKYLRKELFWPYLDELTQNLIQHYQKYENKPSFIHAHYADAGYVGVRLSQALKVPFIFTGHSLGREKKRKLLEAGL 162
gi 500034339  88 ECGGLAYLPKEQLWDSLDNYADNALAYIHEQPHMPHLIHTHYADAGYVGAHLCSMLEIPLIHTGHSLGRSKRKRLLAGGL 167
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 22294303  165 K------PDAIEEQFHLTTRIEAEEQTLASAALIIASTHQEVEEQYRLYDQYDPARMAVIPPGVDTSRFYP-APVPADLP 237
gi 30180517  167 K------EQAIERQFNLSRRIAAEEEVLVHASLIITSTSQEIEDQYGMYKNTDPRRCQVIPPGTDTSRFSPpGRKPLDPA 240
gi 32398248  168 EskapkpPRELDKKFKFTVREEAEEFALETASMVITSTGQEVEEQYAVYDHYQPDRMEVIPPGVDLDQFYPvDESEPLPR 247
gi 16605569  163 D------HEQIEQTYAIGQRIDAEEFTLAHCSLVITSTRQEIDHQYARYGRFVPEQAEVVPPGVDSIRFHPlQSSSETDV 236
gi 16605567  163 K------INQIEKLYCISERINAEEESLKYADIVVTSTKQESVSQYSQYHSFSSEKSKVIAPGVDHTKFHHiHSTTETSE 236
gi 500034339 168 A------RQEIEAIYNISRRIDAEERTLAAASSVVVSTHQEIQGQYVLYDYYQPDQMQVIPPGTDLNKFYApQGDEAQSD 241
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 22294303  238 FRQELRRFLVEPEKPFIFCLSRPVPRKNVAALLNVYGSDRFLQARANLVLVLGNRTDISKMEASPRQVLMELFLLVDRYD 317
gi 30180517  241 IQAGIDRFLNTPEKPVILTICRPDTRKNLHGLIQAYGSDPSLQDMANLVIIAGSREDIRAMEESQRKIMNDVLLDIDRYD 320
gi 32398248  248 IHDLLTPFLKDSEKPMVVAMARPDERKNIEMLVRVFGENPKFREMANLVLVLGSRDDLREMPSGQRRVLTNVLHLIDVYD 327
gi 16605569  237 VDGLLAPFLRKPSLPPLLAISRAVRRKNIPFLVEAYGRSPVLRQRHNLVLVLGCRDDPRQLEKQQREVFQQVFDLVDRYD 316
gi 16605567  237 IDNMMIPFLKDIRKPPILAISRAVRRKNIPSLVEAYGRSEKLKRKTNLVLVLGCRDNTFKLDSQQRDVFQKIFEMIDKYN 316
gi 500034339 242 IAKQLARFLTHPDKPIILALSRPDPRKNITTLVEAYGQSPQLQEMANLVIIAGNRDDIRDMDAGAQEVLTSLLMTMDLYD 321
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 22294303  318 LYGKVAYPKTHRSDEVPDLYRLAAQQRGVFINPALTEPFGLTLIEAAACGLPILATADGGPQEIIRHCRNGLLFDALDLE 397
gi 30180517  321 LWGKIAIPKHFMVEDVPEVYRLAVRRRGIFVNSALTEPFGLTLIEAAASGLPIIAPEDGGPRDIITNCRNGLLVNTLNPS 400
gi 32398248  328 LYGHVAYPKAHRPSDVPELYRLTARRKGIFVNPALTEPFGLTLLEAAASGVPIVATNDGGPRDIIANCQNGLLIDPLSAE 407
gi 16605569  317 LYGRVAYPKQHRRDQIPAIYRWAALHRGLFVNPALTEPFGLTLLEAAACGLPMVATDDGGPRDILARCDNGLLVDVTDLE 396
gi 16605567  317 LYGKVAYPKKHSPANIPSIYRWAASSGGIFVNPALTEPFGLTLLEASSCGLPIIATDDGGPNEIHAKCENGLLVNVTDIN 396
gi 500034339 322 LYGKMAMPKHHQADDVPQLYRLAALSKGVFVNPALIEPFGLTLIEAAACGLPLVATEDGGPIDIVSNCKNGLLIDPLDGE 401
                        410       420       430       440
                 ....*....|....*....|....*....|....*....|....*
gi 22294303  398 AIRSALHQAFQSDSQWQTWADNGLKGVQAHYSWHSHVEMYLQALD 442
gi 30180517  401 DIASALKDALSDRKRWRNWSRNGIASVRRHYTWDAHVSKYLREAD 445
gi 32398248  408 DIDHALMRCLTEPEQWQTWSENGIEGSRTHYSWANHVDRYLRDVT 452
gi 16605569  397 ALQDVMEQAGSDADQWRLWSDNGIVAVSRHFSWDAHVCHYLALMK 441
gi 16605567  397 QLKIALEKGISNSSQWKLWSRNGIEGVHRHFSWNTHVRNYLSILQ 441
gi 500034339 402 AIAQALMDILSDQGQWQRFAQAGQQGVRAHYSWQAHVEKYLAMIQ 446
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap