1KZH


Conserved Protein Domain Family
PFKA_PPi

?
TIGR02477: PFKA_PPi 
Click on image for an interactive view with Cn3D
diphosphate--fructose-6-phosphate 1-phosphotransferase
Diphosphate--fructose-6-phosphate 1-phosphotransferase catalyzes the addition of phosphate from diphosphate (PPi) to fructose 6-phosphate to give fructose 1,6-bisphosphate (EC 2.7.1.90). The enzyme is also known as pyrophosphate-dependent phosphofructokinase. The usage of PPi-dependent enzymes in glycolysis presumably frees up ATP for other processes. TIGR02482 represents the ATP-dependent 6-phosphofructokinase enzyme contained within pfam00365: Phosphofructokinase. This model hits primarily bacterial, plant alpha, and plant beta sequences. [Energy metabolism, Glycolysis/gluconeogenesis]
Statistics
?
PSSM-Id: 131530
View PSSM: TIGR02477
Aligned: 11 rows
Threshold Bit Score: 834.301
Threshold Setting Gi: 29834717
Created: 8-Oct-2014
Updated: 11-Oct-2014
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1KZH_A         6 FKQERQKYIPKLPNILKKdFNNISLVYGENTEAIQD-RQALKEFFKNTYGLPIISFTEGESSl------SFSKALNIGII 78
gi 11528427    7 LQKARYGYVPKLPPVLQDeIARIQAELGQPTEAVAD-REDLKRLFANTYGKPIATLTRGSNP-------EAGRRRTVGVI 78
gi 29337610    6 LQIARAAYQPKLPKALA--TGAVKAVAGAATQSVAD-QEAIKALFPNTYGMPLITFEAGEAV-------QLP-AMNVGVI 74
gi 2317746     6 LHKYRLQYKPVLPKHIAD-IDNITIEEGAKTQSAVN-QKELSELFKHTYGLPICNIVAGKNA-------DIHRVIRCGFI 76
gi 41817482    6 MQRLRYNYEPKIPKVFAEpLSLIKPEIGEATHAQSN-QAELKEIFPHTYGMPIIRFVKGKSE-------VEHKPLKFGVI 77
gi 2499489    16 VQSSRIEHVLPLPSVLN---HPFKIVQGPPSSAAGN-PDEIAKLFPNLFGQPSAMLVPDVADs-----lDSNQQLKIGLV 86
gi 16304156    4 FELYRRQYNPLLPASLQG--TGYTLKKGEPMAPVAD-GEEIAKQFPMTTNLPAISIEPSTEQs------KLLEPLTIGVI 74
gi 29834717   11 FELQRLHYRPETLSFLNG---ITSLHIVDSTEPPAI-PKNLQEHIPNLCSIPEVTIEKGEATp--------SQPLKIGVL 78
gi 3790102    14 LQQLRSLYQPELPPCLQGtTVRVEFGDSTTTADPAD-THSISRSFPHTYGQPLAHFLRATAKvpdaqiiTEHPAIRVGIV 92
gi 497916390   5 KHSSLCQKTPPLCRELQKaPALLLTEDTRFSALLNDrVETVAQLFPCTYESPYRKFIPKSDLp------LDIAPLKVGVM 78
gi 51572854    6 FQQERKKYVPKLPNILKKdFKNISLVYGEKTEAIQD-RQALKEFFKNTYGLPIVSFTEGESSn-----lSFSKALNIGII 79
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1KZH_A        79 LSGGPAPGGHNVISGVFDAIKKFNPNSKLFGFKGGPLGLLENDKIELTESLINSYRNTGGFDIVSSGRTKIETEEHYNKA 158
gi 11528427   79 LSGGPAPGGHNVICGLFDALKKANRESTLIGFKGGPSGILDDEWIEFTDSLINQYRNTGGFDIIGSGRTKIETPEQFAKA 158
gi 29337610   75 LSGGQAPGGHNVISGLFDGIKKLNPESKLYGFILGPGGLVDHNYMELTADIIDEYRNTGGFDIIGSGRTKLETEAQFEKG 154
gi 2317746    77 LSGGPAAGGHNVVAGLFDGLMKGNKENKLYGFRCGAGGILSNDYIEITAELVDKHRNTGGFDLVGSGRTKIETEEQFATA 156
gi 41817482   78 LSGGQAPGGHNVISGLFDALKKGNANSKLYGFLRGPEGLVKGRYVEIKKALIDKYRNTGGFDIIGSGRTKIETEEQIESS 157
gi 2499489    87 LSGGQAPGGHNVISGIFDYLQDRAKGSILYGFRGGPAGIMKCNYVQLTADYIHPYRNQGGFDMICSGRDKIETPEQFKQA 166
gi 16304156   75 FSGGQAPGGHNVLCGLYDKLQQLAPNSKLLGFLGGPKGLMDNKHMILTKEYLATFRNMGGFHAIGSGRDKIASTKDFDAA 154
gi 29834717   79 LSGGQAPGGHNVVIGLFEGLRAFNPKTKLYGFIQGPLGLTRGLYKDLDISVIYDYYNVGGFDMLSSSKEKIKTKEQKSTI 158
gi 3790102    93 FCGRQSPGGHNVVWGLYDAIKLHNPKSTLLGFLGGSEGLFAQKTLEVTKEIFSTYKNQGGYDMLGRTKDQIRTTEQVNAA 172
gi 497916390  79 LSGGPAPGGHNVILGLLHSIKKLHPHSKLLGFIRNGHGLLNNNTVEITEEFMKEFRNSGGFNCIGTGRTNIITEENKARC 158
gi 51572854   80 LSGGPAPGGHNVISGIFDAIKKFNANSKLFGFKGGPLGLLENDKIELTESLVNSYRNTGGFDIVSSGRTKIETEEHYDKA 159
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1KZH_A       159 LFVAKENNLNAIIIIGGDDSNTNAAILAEYFKKNGENIQVIGVPKTIDADLRN-DHIEISFGFDSATKIYSELIGNLCRD 237
gi 11528427  159 LENAKKHGLDALVIIGGDDSNTNAALLAEYFVQQGAPIQVIGIPKTIDGDLKN-EYIEASFGFDTATKVYAELIGNIARD 237
gi 29337610  155 FEIIKELGIKALVIIGGDDSNTNACVLAEYYAAKKYGVQVIGCPKTIDGDLKN-DMIETSFGFDTACKTYAEVIGNIQRD 233
gi 2317746   157 FKHITALKLNAMVVVGGDDSNTNAALLAEYFAAHGSDCVFVGVPKTIDGDLKN-QYIETSFGFDTACKTYSELIGNIQRD 235
gi 41817482  158 IQNVKKLKLDALIIIGGDDSNTNAAFLAKYFIQAKLDTKVIGVPKTIDGDLKN-QYIETSFGFDTATKLYSELIGNICRD 236
gi 2499489   167 EETAGKLDLNGLVVIGGDDSNTNACLLAENFRSKNLKTRVIGCPKTIDGDLKC-KEVPTSFGFDTACKIYSEMIGNVMID 245
gi 16304156  155 ANTAAVEKLDGLVIIGGDDSNTNACLLAEDFIKRGLKTRVIGVPKTIDRDLISkRGIETSFGFDTSCKVYSELIGNLCYD 234
gi 29834717  159 LTTVKKLKLDGLLIIGGNNSNTDTAMLAEYFLKHNCTIPIVGVPKTIDGDLKN-FWIETPLGFHTSCRIYSEMIGNLEKD 237
gi 3790102   173 LTACKNLNLDGLVIIGGVTSNTDAAYLAETFAEAKCPTKVVGVPVTLNGDLKN-QFVETNVGFDTICKVNSQLISNVCTD 251
gi 497916390 159 LQTANQLDLDGLVIIGGDGSNTATAILAEYFAKHRAKTVLIGVPKTIDGDLQH-LFLDLTFGFDTATKFYSSIISNISRD 237
gi 51572854  160 LLVAKENNLNAIVIIGGDDSNTNAAILAEYFKKKGENIQVIGVPKTIDADLKN-NHIEISFGFDSATKIYSEMIGNLCRD 238
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1KZH_A       238 AMSTKKYWHFVKLMGRSASHVALECALKTHPNICIVSEEVLAKKKTLSEIIDEMVSVILKRSLNGDNFGVVIVPEGLIEF 317
gi 11528427  238 AISSRKYWHFIRLMGRSASHIALECALQTHPNVCIVSEEVREKNMTLSQIVDQIVDAVVKRAAKGENFGVVLVPEGLIEF 317
gi 29337610  234 CNSARKYWHFIKLMGRSASHIALECALQVQPNVCIVSEEVEEKDMSLDDVVTSIAKVVADRAAQGNNFGTVLIPEGLVEF 313
gi 2317746   236 AISSRKYWHFIKVMGRSASHIALEAALETQPTYCIISEEVEDKKMTVSQIASEIADIVIERHKKGLNFGVVLIPEGLVEF 315
gi 41817482  237 VNSARKYWHFIKLMGRSASHIALECALKTQPNVCLIGEELAEKKVTLQQVTDYIVDIIVKRSQKGENFGVVLVPEGIIEF 316
gi 2499489   246 ARSTGKYYHFVRLMGRAASHITLECALQTHPNITIIGEEVAAKKLALKDVTDYIVDVICKRADLGYNYGVILIPEGLIDF 325
gi 16304156  235 ALSAKKYWHFIRLMGRSASHITLECGLQTHPNICLIGEEILAKNMTSKQVFEYMADIIAQRAANGKNYGICLIPEGLIEF 314
gi 29834717  238 TLSIKKYHHFVRLMGQKASYTTLECGLQTLPNVTLISEHIAMRKISLQKLSEHIAMGLVNRYRSGKNYSTILIPEGLIEH 317
gi 3790102   252 ALSAEKYYYFIRLMGRRASHVALECTLQSHPNMVILGEEVAASKLTLFDLTKQICDAVQARAEQDKNHGVILLPEGLIES 331
gi 497916390 238 ALSCKGHYHFIKLMGRSSSHITLECALQTHPNMALIGEEIAEKGTSLSALIQGICEMISDRAAMGKYHGVILIPEGVIEF 317
gi 51572854  239 AMSTKKYWHFVKLMGRSASHVALECALKTHPNICIVSEEVLAKKKTLFEIVDEMVFVILKRSLNGDNFGIVIVPEGVIEF 318
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1KZH_A       318 IPEVKSLMLELCDIFDKNEGEfkg-lniEKMKEIFVAKLSDYMKGVYLSLPLFIQFELiksI---LERDPHGNFNVSRVP 393
gi 11528427  318 IPEVGALIDELNTLLAKEAEVfnriddpRERISWVKGKLSGNNQHVFSSLPETIQAQL---L---MDRDPHGNVQVSRIE 391
gi 29337610  314 IPAMKRLIAELNDFLAANAEEfsqikksHQRDYIIR-KLSPENSAIYASLPEGVARQL---T---LDRDPHGNVQVSLIE 386
gi 2317746   316 IPEVIALIKELNNLLAHKKEEyskitefSAQKAFVCENISESCAATFKNLPDNIRKQL---L---LDRDPHGNVNVSAIE 389
gi 41817482  317 IPEMDELIEEINDIMAEKTSAfsklktfAGKKSWLQKHLSKKAFALFDNLPENISLQL---L---MDRDPHGNVQVSRIE 390
gi 2499489   326 IPEVQNLIAELNEILAHDVVD---------EGGLWKKKLTSQSLQLFEFLPVAIQEQL---M---LERDPHGNVQVAKIE 390
gi 16304156  315 IPENNKLFDYLNNKLLPGWQG-------EITAELVAQKLPADLKVTFESIPPTIRTQL---L---LDRDPHGNIAISQIE 381
gi 29834717  318 VFDTRKLVNELNVLLLDNNLN----------LDNVQSKLSPESLKTLSSLPIEIAHQL---L---IARDSYGNVRVSKIA 381
gi 3790102   332 IPEVYALLKEIHSLLRQGVPV-----------DNISSQLSPWASALFEFLPPFIKKQL---L---LYPESDDSAQLSQIE 394
gi 497916390 318 IPEIQTLVKEIESFPEQTDLS---------------QALSPSSQQLLHQFPEDIRHQL---L---YNRDAHGNVYVSQIS 376
gi 51572854  319 IPEVKSLMVELCNIFDKNIVEfkg-lniEGMKEVFVAKLSDYMKKVYLSLPLFIQFEL---VnsiLERDPHGNFNVSRVP 394
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1KZH_A       394 TEKLFIEMIQSRLNDMKKRGEYKGS-FTPVDHFFGYEGRSAFPSNFDSDYCYSLGYNAVVLILNGLTGYMSCIKNLNLKP 472
gi 11528427  392 TEKLLIEMVSSRLKALKEEGAYKGK-FSALNHFFGYEARCAFPSNFDADYCYALGFTAFVLIANGLTGYIAAIKNLARPA 470
gi 29337610  387 TEKLLSEMVATKLAAWKEDGKYVGK-FAAQHHFFGYEGRCAAPSNFDADYCYSLGYTASMLIADGKTGYMSSVRNTTAPA 465
gi 2317746   390 TESFVSGIVK---AEIVKRG-IKVP-FTPVHHFFGYEGRCAFPSNFDSTYCYALGYTAFILLALKKTGQICCISGLQKPA 464
gi 41817482  391 TEKLLIDLVTRKITEMKKEGTYNGK-FSTYAHFFGYEGRSAFPSNFDSDYCYTLGFTAFLLALNGFSGYIASVKNLTDEV 469
gi 2499489   391 TEKMLIQMVETELEKRKQQGTYKAH-FKGQSHFFGYEGRCGLPTNFDSTYCYALGYAAGALLHSGKTGLISSVGNLGAPV 469
gi 16304156  382 TEKFLVSGVQ----QVIKERELKIK-FSALYHFFGYEGRCAAPSAFDSSYCYGLGSVAAVLLGNGITGYMSCLKNLSEQP 456
gi 29834717  382 TEELLAALIK----KEIQKIEPKME-FQPVNHFFGYESRAGFPSNFDANYGLALGIVSALFLVRQRTGYMVTINNLARSY 456
gi 3790102   395 TEKLLAHLVEVEMNKRLKEGTYKGKkFNAICHFFGYQARGSLPSKFDCDYAYVLGHICYHILAAGLNGYMATVTNLKNPA 474
gi 497916390 377 VDKLLIHLVQN-----HLETHFKHVpFNAISHFLGYEGRSGTPTHFDNVYSYNLGYGAGILVFNRCNGYLTTIEGLTNPI 451
gi 51572854  395 TEKLFIEMVQARLSEMKKRGEYKGS-FIPVDHFFGYEGRSAFPSNFDSDYCYSLGYNAAILILNGLTGYMSCIKNLNSKP 473
                        490       500       510       520       530       540       550       560
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1KZH_A       473 TDWIAGGVPLTMLMNMEERYGE------KKPVIKKALVDLEGRPFKEFVKNRDKWALNNLYLYPGPVQYFGSSEI----- 541
gi 11528427  471 VEWKPMGIPLTMMMNMEKRHGK------MKPVIRKALVDLEGAPFKRFATQRDAWATESAYVFPGAIQYYGPDDV----- 539
gi 29337610  466 AEWIAGGVPITMMMNMERRHGE------MKPVIQKALVKLDGAPFKAFAAQRDRWAVETDYVYPGPIQYFGPTEV----- 534
gi 2317746   465 EEWICGGVPLTIMMNMEQRNGE------MKPVIKKALVEIEGKPFKFYQSKRAQWASAEDFVFPGAIQYFGPSEV----- 533
gi 41817482  470 EHWLPCGVPLSMMMNMERRKGK------MTPVIKKSVVDLNGKPFKTYEKNRDKWAVETLYRFPGAIQYFGDLEV----- 538
gi 2499489   470 AEWTVGGTALTSLMDVERRHGK------FKPVIKKAMVELEGAPFKKFASLREEWALKNRYVSPGPIQFMGPG------- 536
gi 16304156  457 DKWIAGAIPLTSLMNIEMRHGA------RTAVIQKQMVDLAGRPFGFLVVNREKWAEQDCYQQPGPIQLIECQDVegrnv 530
gi 29834717  457 SEWIGGATPLYKMMQLEHRLGE------DTPVIKTDSVNPHAPEVQYLLNQSDACLMKDLYCFPGPLQYFGEERL----- 525
gi 3790102   475 NKWRCGAAPITSMMTVKRWSQNpgassiGRPAINPATVDMRGKAYELLRQNATRFLLDDLYRNPGPVQFDGPG------- 547
gi 497916390 452 EKWRLRALPIVRMLTTKTNKDGt-----LYPLIKKGLVDISSPVFNKFSLYRKIWALEDSYRFVGPLQIHSPEDSh---s 523
gi 51572854  474 TDWIAGGVPLTMLMNMEERYGV------QKPVIKKALVDLEGRPFKEFVENRDKWAFNNLYLYPGPVQYFGSSEI----- 542
                        570
                 ....*....|..
1KZH_A       542 VDEITETLKLEL 553
gi 11528427  540 CNQPTMTLKLEQ 551
gi 29337610  535 CDQATKTLQLEQ 546
gi 2317746   534 CDQPTKTLLLEQ 545
gi 41817482  539 CDIPTKTLLLEK 550
gi 2499489   537 SDAASHTLLLEL 548
gi 16304156  531 VYQSSVTLLEEA 542
gi 29834717  526 LDQRPLTLLWGN 537
gi 3790102   548 ADAKAVTLCVED 559
gi 497916390 524 DDFPPLILFLNH 535
gi 51572854  543 VDEITETLKLEL 554
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap