Conserved Protein Domain Family
fliN

?
TIGR02480: fliN 
flagellar motor switch protein FliN
Proteins that consist largely of the domain described by this model for this protein family can be designated flagellar motor switch protein FliN. Longer proteins in which this region is a C-terminal domain typically are designated FliY. More distantly related sequences, outside the scope of this family, are associated with type III secretion and include the surface presentation of antigens protein SpaO required or invasion of host cells by Salmonella enterica. [Cellular processes, Chemotaxis and motility]
Statistics
?
PSSM-Id: 131533
View PSSM: TIGR02480
Aligned: 17 rows
Threshold Bit Score: 89.9641
Threshold Setting Gi: 6225365
Created: 8-Oct-2014
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 45479284  98 NMDLIMDIPIDVQIVLGTSRMLVSGLMSLEEGATIALDRKIGEPVEIMVNGRRIARGEITVLEDddtRFGVKLIEVMSTR 177
gi 7025357   30 DLESVYDIPVQISAVLGKCTMQVSSLMKLGRGAVVELDRKVGEAIDIYVNNRLVARGEVVVVED---RLGVTMTEIIKSD 106
gi 15077432  26 EISAIYDTEVEVSVVLGTSTIRVRDLLKLGRGAIVELDRKIDDLSDIIVSGRMVGRGEVTIVED---KIAVTFREFARVS 102
gi 6225365   35 LIQHFSDIPVEVEVVVGRANKTLGELLAMGIGSVIEIDREPKDLVDIKVNGKLIAKGELVIIDG---KIGVKIKEVVKEq 111
gi 28203819 331 NIDLIMDVPLDISVVLGRTKLNIKEILNLGTGSLIELDKLAEEPVEILVNGKPVAFGEVVVIDE---NFGVRITDIVNNV 407
gi 32262698 194 NINMILDVRLNVKVRIGQKRMLLKDVIAMDIGSVIELNQLANDPLEILVDDKVIAKGEVVIVDG---NFGIQITDIGTKR 270
gi 45600949  99 NLNLLMDVNLALTVELGRTNMFIKDVNGLNEGVVVELDKNVGEDLDILANGRLVGRGKLVAMDD---FYGIQITEIVDQS 175
gi 46395830  53 KMKFIMDVPVHLTIEVGTVKITIKDLLELRSKSILVLDKHAGDPLNILVNGYVIATGELVVTEN---KYGIRIINIIDNS 129
gi 32263128  30 NYTGLLDMEALFNAELGSTKIPLGEILRFEKGSIIDLGKPAGESVEIFINGRVIGKGEVMVYER---NLAIRINEILDSN 106
gi 51856840 146 LRGVLLDIELTLSVELGKARLPLGEILSMGPGSVITLDRLASEPLNVKVNGLPAMTAEVIAIGE---KYGIRIVESQLPN 222
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap