Conserved Protein Domain Family
flgG_G_neg

?
TIGR02488: flgG_G_neg 
flagellar basal-body rod protein FlgG, Gram-negative bacteria
This family consists of the FlgG protein of the flagellar apparatus in the Proteobacteria and spirochetes. [Cellular processes, Chemotaxis and motility]
Statistics
?
PSSM-Id: 131541
View PSSM: TIGR02488
Aligned: 12 rows
Threshold Bit Score: 380.931
Threshold Setting Gi: 32447913
Created: 8-Oct-2014
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 32447913   5 TLYTAATGMEAMQTKLDVIANNLANINTTGFKKDRANFEDLLYRTEVYPGVQDS-TQTPTAVGTQVGLGVRVTSTQTDQR 83
gi 4378856    5 PLQVARTGLDAQNTRMRIIANNLANVNTTAFKRDRAAFETLAYQAERQPGAQST-NSYYYATGLTLGSGVQTIATERQET 83
gi 52427990   4 SLYIAATGMNAQQAQMDVISNNLANVSTNGFKGSRAVFEDLLYQTVRQPGANST-QQTELPSGLQLGTGVQQVATERLYT 82
gi 5361010    4 ALWVSKTGLDAQQTNIATISNNLANASTVGYKKSRAVFEDLFYQNINQPGGQSS-QNTELPSGLMLGAGSKVVATQKVHT 82
gi 28808407   4 ALWVSKTGMAAQDTKMTAISNNLANVNTVGFKRDRVVFEDLFYSIQRQPGAQVD-QVNELPSGVQLGSGVRVVGTQKVFT 82
gi 11095160   5 AMHVASTGLNAQQTRMQVISNNLANVNTTGFKRDRANFESLLYQTWKPGGAQTS-EATAMTSPSAVGTGVRVVSTEKLYT 83
gi 27354105   3 ALHTAATGMAAQELNVQVISNNIANLRTTGFKKQTAAFQDLIYEHVRRVGAQASdQGTIVPVGVDIGGGVKTVGTPRSMT 82
gi 41816711   4 SLWTAATGMNTQQANIDTVANNLANVNTSGFKKQRAEFEDLIYQTVKTAGTPATeD-TITPVGVQMGHGARLAATQRIFE 82
gi 46448340   4 SLWTAATGMVAQQLNIDVISHNLANVNTSGFKKSRAEFEDLMYQNMRIAGSATEgD-SRIPVGIQVGMGVRPTAVHKFFS 82
gi 39574665   4 SLNTAATGMAAQQTNMDVIANNIANVSTAGFKRSRAEFEDLMYQTQKEPGTASGlN-AYSPNGVQVGLGVRTAGVQKDFA 82
gi 34483822   4 ALYTATTGMMGQQLQIDVTSNNIANVNTIGYKKQRAEFADLFYQVMEYAGSSTSeT-TLSPTGIEVGLGVRPTAITKIFS 82
gi 17380480   3 ALSIAATGMNAQQLNLEVIANNIANINTTGYKRARAEFSDLLYQTERAQGVPNRsNQAIVPEGAIIGLGVQTSAVRNLHI 82
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 32447913  84 QGTLQQTGRDLDVAIQGGGYFRVVDPSSQdTMYTRAGNLDINANGELVMGsaqVGRLLDPPITIPPDATA--VVINSNGE 161
gi 4378856   84 QGSFVNTGNSLDLAVSGVGYFQIQLPDGT-IGYTRAGNFQLSQDGQIVTD---DGKPLIPNINIPQNAEQ--ITIGEDGT 157
gi 52427990  83 QGSLQQTGNSKDVAINGQGFFQVLMPDGT-NAYTRDGSFQTNAQGQLVTS---SGYQVIPAITIPQNANS--LTIGSDGV 156
gi 5361010   83 HGNAQTTTNALDMMVEGDGFFQVTLPDGN-IGYTRNGQFTLNGEGTLVTSg--SGYPVEPEIVIPEDAIS--ITVGTDGE 157
gi 28808407  83 QGNTQNTTQDLDLAVMGQGFFQIENSDGQ-IMYTRNGQFHINSEGLMVNS---QGLPLEPQIQIPDNATS--FSVGVDGT 156
gi 11095160  84 QGSLANTDNALDLAIDGPGFFQVLMPDGR-MGYTRNGTFSQNAEGTITTP---SGYVVQPEIQIPEGAVS--VTISSDGI 157
gi 27354105  83 QGTLSQTGNDLDLAISGEGFFKILMPDGT-FQYTRDGTFQMDNQGRVVTA---QGNPVQPTITIPNNASG--LTVNEQGQ 156
gi 41816711  83 QGSLQNTGVTSDIAIQGEGFFRVLQYDGT-YAYTRDGSFKIDADRQLVTS---NGLRVLPEIIFPEGYREntIAVSRDGR 158
gi 46448340  83 QGDFQNSGNPLDIAIEGDGFFQVLVN-GE-PRYTRAGAFKLNQDGTVVTA---NGYVLQPEFTVPAETKN--VVVTEAGH 155
gi 39574665  83 GGQAQITKNPLDLQIEGSGFFQVLTADGE-TAYTRDGAFKKDPNGRLVDK---NGNTLQPEITVPANVSG--IEVAPTGE 156
gi 34483822  83 QGNFKETGNNLDIAITGNGFFQIQLPDGT-TAYTRNGAFKPDDEGNIVNS---DGYRLIPEITIPEDATQ--INIGVDGT 156
gi 17380480  83 QGSLVNTGNDYDLALVGRGWFQIETPDGE-TVYTRSGAFNTNATGQLVTI---DGYTVVPGVTVPQDATE--IVFTSSGQ 156
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 32447913 162 VMVRQPGQTELTNQGQIQLAQFINPDGLLKNGENLYSETDASGPEQINNPGTDGMGVLRQGNLEASNVEPVQELIDLITT 241
gi 4378856  158 VSVQLQGQTQSNQVGQIQTVRFINPAGLQATGQNLYIETQSSGQPQIGLPQQDGMGYILQGELEQSNVNIVQELVDMIET 237
gi 52427990 157 VSVTQPGSNNAVQIGALQIATFINPAGLDAKGENLFAETTSSGAPNVSQPGLNGAGTLKQGYVESSNVNVVQELVNMIQT 236
gi 5361010  158 VSVRVRGQQDNQVVGQLTITDFVNPGGLEPIGQNLYLPTGASGDPQEGVPGLDGLGEIRQSMLEASNVNVTEELVNMIEA 237
gi 28808407 157 VTTTTADDPTPQQLGQITLAKFINPAGLEAVGGNLFRETEASGPADELIAGADGAGSIKQGALEGSNVQVVEEMVDMITT 236
gi 11095160 158 VSVLMPDETEAQEVGQMTLATFANPRGLQPVGETFAVETGASGEAVIGNPVEPGFGKLVQGSLEASNVNVVQELVDMIET 237
gi 27354105 157 VSVTLPGSSTSAVQGQLGLTRFINKAGLQPVGNNQFTETPSSGPPQDGTANTEGYGKITQGSLEQANVDVVSEMSDLIAA 236
gi 41816711 159 VTVKVGDIDDPIEVGQIELYRFQNNAGLSAEGSNLFRQTPASGTAIPGRPGFTGFGRTEHKFLEMSNVSTVSEMVNMIVA 238
gi 46448340 156 IAALDANGQE-LAAADIPLYTFINPAGLDAIGRNLYVPSEASGEAVEGVPGEDNVGTLAQGFLEMSNVEVVDEMVNMIVG 234
gi 39574665 157 VRVITGLNDVPQTIGQIDVVNFVNPAGLKAMGKNLFTQTPSSGQAIASRPGLNGTGYLAQGQLESSNVNIVDEMVNMITA 236
gi 34483822 157 VSVLQGNQTEVNTIGQIEIATFINPAGLHSLGDNLYLNTNASGDPIVDTPGLNGFGQLRQGFVELSNVKLVEEMTDLITG 236
gi 17380480 157 VMVRIGNDTELQEIGQLTIANFVNEAGLEPMGENLFRQTPASGDPIVGTPADPGFAQVKQNYLESSNVDPVKEITDLISA 236
                       250       260
                ....*....|....*....|....*
gi 32447913 242 QRAFELNSQAVQAGDQVMQNISQLR 266
gi 4378856  238 QRAYEVNSKMVKASDEMLQYINQQI 262
gi 52427990 237 QRAYEINSKAVTTSDQMLQTVTQMS 261
gi 5361010  238 QRVYEMNSKVISSVDKMMSFVNQQL 262
gi 28808407 237 QRAYEMNAKVVSAADDMLKFVSQSM 261
gi 11095160 238 QRAYEVNSKSISASDEMMQYLSNKL 262
gi 27354105 237 QRAYEMNAKVISAADQMMQSTTALF 261
gi 41816711 239 QRAYEFNSKAIQTSDNMLGTAVSLK 263
gi 46448340 235 QRAYEMNSKAISTSDQMLQTAVNLK 259
gi 39574665 237 QRAMETNSKVMQASDQMLQAINNLR 261
gi 34483822 237 QRAYEANSKSIQTADSMLQTVNSLK 261
gi 17380480 237 QRAYEMNSKIIQAADEMAATVSKNL 261
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap