Conserved Protein Domain Family
flgE_epsilon

?
TIGR02489: flgE_epsilon 
flagellar hook protein FlgE, epsilon proteobacterial
Members of this family are flagellar hook proteins, designated FlgE, as found in the epsilon subdivision of the Proteobacteria (Helicobacter, Wolinella, and Campylobacter). These proteins differ significantly in architecture from proteins designated FlgE in other lineages; the N-terminal and C-terminal domains are homologous, but members of this family only contain a large central domain that is surface-exposed and variable between strains.
Statistics
?
PSSM-Id: 131542
View PSSM: TIGR02489
Aligned: 3 rows
Threshold Bit Score: 969.034
Threshold Setting Gi: 3286760
Created: 8-Oct-2014
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 32263256   1 MLRSLWSGVSGMQAHQIALDVESNNIANVNTVGFKYSRASFVDMLSQIKLIATSPYKnGLGGQNDFSVGLGVGIDATTKV 80
gi 34483783   1 MLRSLWSGVSGMQAHQVALDVEGNNIANVNTTGFKYSRANFSDMLSQVNRIATSPYG-GLGGQNDYSIGLGTSINSTTKI 79
gi 3286760    1 MMRSLWSGVRRLQAHQVAMDVEGNNISNVNTTGFKYSRADFGTMFSQTVKIATTPTD-GRGGQNPLQIGLGVSVSSTTRI 79
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 32263256  81 FSQGNTQNTDVKTDVAIEGDGFFIISPDRGTTHNYTRNGEFLFDANGNLVTTGGYVVQGWVRpPLEAAESGTMSDFDFFR 160
gi 34483783  80 FGQGSIQDTTNKMDLAIGGDGFFIVSGNGGRTNAYTRDGAFGFDAAGNMVNNAGYIVQGWTR-DLNSGSTSCYSDALYNV 158
gi 3286760   80 HSQGSVQTTNSNTDVAINGDGFFMVSDDGGLTNYLTRDGAFKLDAYGNFVNNSGFIVQGWNI------------NWDDQT 147
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 32263256 161 VDNTGPVRNIQIDPGMVMPARATKTITLRANLNAGRHIDQMQ-DVAALDSTA------QTAAD----GVVAIYDSRG--- 226
gi 34483783 159 VDTTVPISGIKIEPKMVIPAKATTQVNLDANLTAGDTTDKLG-CMYALDSTS------VTAAD----GIAARYDSAG--- 224
gi 3286760  148 IDSSRSPQNIFIDPGMHIPAAKSTEVAIKANLNSGLNIGTSSrNLYALDSVHgynnktQRAEDendtGTTQFYTTSKnsv 227
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 32263256 227 VLTQVGEDLGVLFNDDGDAFALNENQGIWLSYKTAAIRHETVVTNEVs---------------------TIGINGEKVSF 285
gi 34483783 225 NKIQMAEDMGVLFNASGNALKLSEGQGVWVSYSQATATQAVAVATTG----------------------TITLNGTTITF 282
gi 3286760  228 EVTEKGVDAGSLFNASGTGLNLRDGQGIWVSYADAKYSTNKVGVSAFdanlqqnqtaafwgsadqrvnlDITLNGVRIQN 307
                       330       340       350       360       370       380       390       400
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 32263256 286 SNNSAITGVSSIVAAQNAINSLRDKTGVNAYVDAG--QLRIENRNQMDGGEKVKNIRITSGGt---GVLQN--------- 351
gi 34483783 283 TNDSTISGVSSLVAAQNAINAKKSETGVEAFATGG--QLRLVNDNSLDGNASKKNVIITASG----GALAN--------- 347
gi 3286760  308 AEIQNIDDAIAYINTFTAPTDTRDGTGVRAVKSADgsGIEFVNDNSDGTTDNMKNINLIVSDantaGELWNavwdpalng 387
                       410       420       430       440       450       460       470       480
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 32263256 352 ---FVQGEED--------------------------------------ITAFRYRYTKS-------------------ED 371
gi 34483783 348 ---FTAADNS--------------------------------------ITAFRYAYTTA-------------------SD 367
gi 3286760  388 qggFTFNQNTpaitrngtslwtadqitpnntpdgntavtltgtdrvevITAHKYIYSSNpvdigpmynpdggpsftddDG 467
                       490       500       510       520       530       540       550       560
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 32263256 372 ADST----------------------TGQFRTTEDLRALIQYDANM-IKNPEkTYYEST---ATVGVTINRWGMFEIANH 425
gi 34483783 368 ADST----------------------SRLFRTTEDLRALLQQDANN-IKHGG-GYVDSTgtnASVKVTINKTGMFEILNQ 423
gi 3286760  468 VDTTrptdpasaaywdamnggllntnARTFRTTEDLRELLQRDARYgVDYDGsGNFAAAdvnQAVKVVVTANGNFAISNA 547
                       570       580       590       600       610       620       630       640
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 32263256 426 DDAD---------------DEQRNLSLYVTSHFSDN--VTNNVLFKETMKALNTASLIEGGAAVNTGKIVKATHATSVDI 488
gi 34483783 424 DDGD---------------TTTGNLSLTVSSYYDTN--VTSNVLFKSAMKGLNTGILVEGGSSTTSASLMAAKHTATTDI 486
gi 3286760  548 KENSsipanagtgitgaitTEPKAMSFNITAYSNKAgtVTTNDAFTAIFKAWD-GPLTVGGSIKESEQLKLSAFSAGLEI 626
                       650       660       670       680       690       700       710       720
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 32263256 489 VDSLGSKHNVRFEFWKT-----GDAVWSFRAIVPEPAQFIGGSITKPNVFEGGRASFNSDGSLSGMNPPVLQFDPKNGSK 563
gi 34483783 487 VDSLGNKHTLTVTFRKV-----GPQEWSFSLHVPEPATFVNGSGERPNYFEGGRVTFGEDGGLTGMNPPTIQFNPKSGAS 561
gi 3286760  627 FDSLGSKHTLEVQFVKQsttqdGGNEWQMIIRVPEPAEIN-TTGEGQIISSVGTARFNNDGSLASYTPRTINFSPNNGAA 705
                       730       740       750       760       770       780       790       800
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 32263256 564 GPQRLELKFGANETFGGLTSVDKISETYSINQNGYQAGDLMD--IRFDSNGSLLGAFSNGRSIALAQVALANFANNAGLQ 641
gi 34483783 562 SPQRIDLDFGVSGTFQGLTSTDKESATGNIYQNGYQSGVLED--WRFDSNGVLIGEFSNGKDLALAQVAIASFTNNGGLQ 639
gi 3286760  706 PNQQIKLSFGTSGSNDGLVSSNSASTLTGQATDGYSSGNLKPdaIRVDEKGNLLGEFTNGKTFRVAKIAMASVANNSGLE 785
                       810       820       830       840       850       860       870
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*..
gi 32263256 642 AEGGNVYSQTGNSGEPMVGAANTGRRGGVSGSKLEMSNVDLSRSLTQLIVVQRGFQANSKAVTTSDQILNTLLNLKQ 718
gi 34483783 640 AEGSNLFSQTANSGEPVVGTAGSGGRGKISPSALEMSNVDLSRSLTQLIVVQRGFQANSKTVTTSDQILNTLLQLKQ 716
gi 3286760  786 EIGGNLFKVTANSGNIVVGEAGTGGRGEMKTSALEMSNVDLSRALTELIIIQRGYQANSKTISTSDQMLQTLIQLKQ 862
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap