Conserved Protein Domain Family
PFLA

?
TIGR02493: PFLA 
pyruvate formate-lyase 1-activating enzyme
An iron-sulfur protein with a radical-SAM domain (pfam04055). A single glycine residue in EC 2.3.1.54, formate C-acetyltransferase (formate-pyruvate lyase), is oxidized to the corresponding radical by transfer of H from its CH2 to AdoMet with concomitant cleavage of the latter. The reaction requires Fe2+. The first stage is reduction of the AdoMet to give methionine and the 5'-deoxyadenosin-5-yl radical, which then abstracts a hydrogen radical from the glycine residue. [Energy metabolism, Anaerobic, Protein fate, Protein modification and repair]
Statistics
?
PSSM-Id: 131546
View PSSM: TIGR02493
Aligned: 9 rows
Threshold Bit Score: 351.286
Threshold Setting Gi: 41400041
Created: 8-Oct-2014
Updated: 11-Oct-2014
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 20139298   7 RVHSVETMGTVDGPGIRFIVFMQGCLLRCQFCHNPDTWKIgTG-TERSAQDVFDEAIKYKEFWDAS--GGGVTVSGGEPL 83
gi 6580770   33 RIHSTEIGGAVDGPGVRFCAVLGGLRFACQYCHNPDSWFL-KNgRAVTLAEMMEEVASYADFLKRA--GGGITISGGEPL 109
gi 19713712   4 YINSFESFGTKDGPGIRFVVFMQGCPLRCLYCHNVDTWELkDKnYIYTPEEVLAELNKVKAFLS-----GGITISGGEPL 78
gi 12720286   6 RIHSYESCGTVDGPGIRFILFMQGCLMRCQYCHNRDTWDL-HAgKEITVEELMKEVVTYRHFMNAS--GGGVTASGGEAV 82
gi 51854941  18 RIHSVESCGAVDGPGLRFVVFVQGCPLRCRYCHNPDTWDP-GQgAEVTVGSLIEEIQSYVPYMKFS--GGGVTVSGGEPL 94
gi 18144815   5 RIHSLETMGLVDGPGIRFVVFMQGCGIRCAFCHNPDTWCKdKG-TEYTPEELVNKIKRFKTYFNAS--GGGVTFSGGEPL 81
gi 29342057   4 nVHSYESMGTFDGPGLRLVVFLQGCNFRCLYCANPDTIAG-KGgTPTPPEEIVRMAMSQRPFFGKR--GG-ITFSGGEPT 79
gi 41400041  18 NVHSTESLACLEGPGNRFLLFLNGCAARCLYCSNPDTWDEtVG-TPMTVGQLIKKIGNLKNYYINSvgGGGVTVSGGEPL 96
gi 23326183  55 FVHSWDINTSVDGPGTRMTVFMSGCPLRCQYCQNPDTWKM-RDgKPVYLDAMIKKVDRYKDLFKAT--HGGITFSGGESM 131
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 20139298  84 LQVDFLIEFFTLCKA-AGVHTTIDSCGgcftRDPefIEKLDRLMEVTDLILLDIKQINPEKHLKLTTK-SNAPIIDFAHY 161
gi 6580770  110 VQPEFTGALLKAAKY-LGLHTAIDTAG----FLG--AQADDALLSNTDLVLLDIKAFNDKRYKALTGV-ELQPTLAFAKR 181
gi 19713712  79 LQSSFVLEVFKLCKE-NGIHTALDTSG----YIF--NEQAKKVLEYTDLVLLDIKHIDKDMYKKLTSV-DLEPTLNFIKY 150
gi 12720286  83 LQAEFVRDWFSACKK-EGIHTCLDTNG----FVRnyDHVIDELLDVTDLVLLDLKQLNDKIHQNLIGV-PNKRTLEFAQY 156
gi 51854941  95 LQPDFVADLFAECRR-LFIHTALDTSG----FAP--PERARRVLEQTDLLLLDIKHPDLLRHKALTGV-DGRPPRTTARL 166
gi 18144815  82 LQPEFLLECLKLCKKe-GIHTTLDTAG------VglGN-YEEILEYVDLILFDVKETDPEKYKSLVGv-PIDKSLEFLKV 152
gi 29342057  80 FQAKALVPLVRELKE-RGIHVCLDSNG------GlwNEDVEELFKLTDLVLLDIKEFNPNRHQTLTGR-SNEQTIRTAAW 151
gi 41400041  97 TQFGFLSCFLYAVKKhLNLHTCVETTG------QgcTKAWNSVLPHTDLCLVCIKHAIPEKYEQITRTkKLDRCLKFLKE 170
gi 23326183 132 MQPAFVSRVFHAAKE-MGVHTCLDTSG----FLN--TNYTDEMLEDIDLCLLDVKSGDEETYHKVTGG-TLQPTIDFGQR 203
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 20139298 162 LRDKEQPIWIRHVLIPTKTDDPEDLTKLHEFIQTLPN-VKQVDVLPYHTMGVYKWKEMGIRYPLEGIEAPEEEVVALANK 240
gi 6580770  182 LAALKKPVWLRYVLVPGLTDNFNEIANLADFAATLGN-IERVDVLPFHKMGEYKWKASGLAYKLGDTQPPSPALVEDVRG 260
gi 19713712 151 LQEINKPTWIRYVLVPGYTDDIKDLNDWAKFVSQFDI-VKRVDILPFHQMAIYKWEKTNREYKLKDTPTPNKEQIQRAEE 229
gi 12720286 157 LAKRNQPVWIRYVVVPGYTDADEDIHLLGHFIKDMKN-IEKVELLPYHRLGAHKWEAMGEKYELEEVNPPTKESLEHIKS 235
gi 51854941 167 AAAMGIPIWIRYVVVPGWTDSPADVEALADLVQTLPT-VEKVELLPYHLLGRHKWEALGLPYGLDGVAPPSEETLARIRQ 245
gi 18144815 153 TQSMNKKMWIRHVVVPGYTDNKEDLMRIKNFVDGLNN-IEKVELLPYHVLGVNKYEGLNIPYRLEGVPPLDK---KWLKE 228
gi 29342057 152 LEEQGKPFWLRYVLVPGYSDFEEDIRALGEALGKYKM-IQRVEILPYHTLGVHKYEAMGQEYKMKGVKENTPEQLEKAAE 230
gi 41400041 171 LEKRNIPWWCRYVVLPGYTDSKEDIEALIELVKNSPT-CERIEFLPYPELGKNKWEELGIEYPLKNIKQLKKSEIKWICD 249
gi 23326183 204 LAKAGKKIWVRFVLVPGLTDSEENVENVAKICESFGDaVEHIDVLGFHQLGRPKWHELRIPYPLENQKGPNAATRERVAN 283

                ....*
gi 20139298 241 ILETS 245
gi 6580770  261 IFRDN 265
gi 19713712 230 IFRKY 234
gi 12720286 236 ILESY 240
gi 51854941 246 QLADR 250
gi 18144815 229 LEKEI 233
gi 29342057 231 VFKEY 235
gi 41400041 250 MVREA 254
gi 23326183 284 QFKDH 288
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap