1XKP


Conserved Protein Domain Family
type_III_SycN

?
TIGR02503: type_III_SycN 
Click on image for an interactive view with Cn3D
type III secretion chaperone SycN
Members of this protein family are part of the machinery of bacterial type III secretion in a number of bacteria that target animal cells. In the well-studied system from Yersinia, a complex of this protein (SycN) and YscB (pfam07329) acts as a chaperone for the export of YopN (). YopN then acts to control effector protein secretion, in response to calcium levels, so that secretion occurs only after contact with the targeted eukaryotic cell. [Protein fate, Protein folding and stabilization, Cellular processes, Pathogenesis]
Statistics
?
PSSM-Id: 131555
View PSSM: TIGR02503
Aligned: 7 rows
Threshold Bit Score: 116.028
Threshold Setting Gi: 33563632
Created: 8-Oct-2014
Updated: 23-Jan-2015
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1XKP_B         4 IEPIISHFCQDLGVPTSSPLSP-LIQLEMAQSGTLQLEQHGATLTLWLARSLAWHRCEDAMVXALTLTAAQXSGALPLRA 82
gi 47606472    4 IEPIISHFCQDLGVPTSSPLSP-LIQLEMAQSGTLQLEQHGATLTLWLARSLAWHQCEDAMVKALTLTAAQKSGALPLRA 82
gi 46447814    2 LQDTIAAFARRMGMTGFVPSAGgLAAFDIDGVGRLYVEPSDDTLLVYLARAVPAHET-HLPRRLLDLSHYRHAWPLPLQG 80
gi 33563632    4 ADRALHQFGQDIGIEGLAFGPSgSASLALSNGRRLGVECVAGAALVHLAQRVERDAA-SVLLAAWKRAHGQRGSAASIQT 82
gi 34103911    5 TARRLEQFLQLSELPTPRVEPR--MEFSMP-PFRLYIEYLDGRVLLSLARSIEHVHQSEALKRLLASCQPARTQGTPLRA 81
gi 489204477   4 VELAVAQFCQDLRVSVPAPLAR-VVQLDFEDSGTLQLERHGEQLSLWLACDLAWHQAYRGTLRALRLCHARAAGSLPLRC 82
gi 41834177    4 IDASVDDFCRGMGLEAVDFSSAgRVQLSFEQSGTLHIEKHQDCLFLMLAKPLPWHQSNELIKKALSFCHAGQGWPFLIKT 83
                         90       100       110       120
                 ....*....|....*....|....*....|....*....|...
1XKP_B        83 GWLGE---SQLVLFVSLDERSLTLPLLHQAFEQLLRLQQEVLA 122
gi 47606472   83 GWLGE---NQLVLFVSLDERSLTLPLLHQAFEQLLRLQQEVLA 122
gi 46447814   81 GMHG----GQAVVLTRLDGRTATAVDVENAAVLLAGVLDRATA 119
gi 33563632   83 SLWSEgseDWIVAQTRLPERSLDAAALRLAVLGLTNWLDRLEA 125
gi 34103911   82 YILRD---QQVLSCAPSAG---SETNHWLACVQTMRRLLEATA 118
gi 489204477  83 AWSGE---SRLLLCITLEARQVGMPTLHQALQALRSARSEVLA 122
gi 41834177   84 GLLDE---QTMVFSAQIEGDEVTLPTIEQAFALLVRLHKDVVG 123
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap