Conserved Protein Domain Family
MtrF

?
TIGR02507: MtrF 
tetrahydromethanopterin S-methyltransferase, F subunit
This small protein (MtrF) is one of eight subunits of the N5-methyltetrahydromethanopterin: coenzyme M methyltransferase in methanogenic archaea. This methyltranferase is membrane-associated enzyme complex that uses methy-transfer reaction to drive sodium-ion pump. Archaea domain, have evolved energy-yielding pathways marked by one-carbon biochemistry featuring novel cofactors and enzymes. This transferase is involved in the transfer of 'methyl' group from N5-methyltetrahydromethanopterin to coenzyme M. In an accompanying reaction, methane is produced by two-electron reduction of the methyl moiety in methyl-coenzyme M by another enzyme methyl-coenzyme M reductase.
Statistics
?
PSSM-Id: 131559
View PSSM: TIGR02507
Aligned: 3 rows
Threshold Bit Score: 84.1088
Threshold Setting Gi: 3334266
Created: 8-Oct-2014
Updated: 11-Oct-2014
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60
                ....*....|....*....|....*....|....*....|....*....|....*....|....*
gi 39931993  10 GVPMVLNPQMGAIDATVESIRYRAQLIARNQKLDSGVMSTGIIGFAAGFLFSLLMVIILPLMAGL 74
gi 3334266    1 MIILSNKPNIRGIKRVVEDIKYRNQLIGRDGRLFAGLIATRISGIAIGFLLAVLLVGVPAMMSIL 65
gi 45048003 187 GIPTVAEPDIESMKSLNEALDYKVGLMTRDIGLASGVQTETVTGLMYGSVFAVALIAVPIALKFL 251
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap