1XKP


Conserved Protein Domain Family
type_III_yscB

?
TIGR02513: type_III_yscB 
Click on image for an interactive view with Cn3D
type III secretion system chaperone, YscB family
Members of this family include YscB of Yersinia and functionally equivalent (but differently named) proteins from type III secretion systems of other pathogens that affect animal cells. YscB acts, along with SycN (TIGR02503), as a chaperone for YopN, a key part of a complex that regulates type III secretion so it responds to contact with the eukaryotic target cell.
Statistics
?
PSSM-Id: 131565
View PSSM: TIGR02513
Aligned: 5 rows
Threshold Bit Score: 183.092
Threshold Setting Gi: 62738461
Created: 8-Oct-2014
Updated: 23-Jan-2015
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1XKP_C        2 QNLLXNLAASLGRXPFVADXQGVYRLTIDXHLVMLAPHGSELVLRTPIDAPMLREGNNVnVTLLRSLMQQALAWAKRYPQ 81
gi 1781384    2 DHLLSGLATRLGQGPFVADRTGSYHLRIDGQSVLLLRQGDDLLLESPLEHAPLDPQRDQ-LGLLRALLSRVASWSRRYPQ 80
gi 47606251   2 QNLLKNLAASLGRKPFVADKQGVYRLTIDKHLVMLAPHGSELVLRTPIDAPMLREGNNVnVTLLRSLMQQALAWAKRYPQ 81
gi 27550051   2 QTLLNHLASRLGQKPFVSDRQGHYHLHIDNYNLFLRQQGTELVLSSPLSWR-HNPKDPSgAELLKTLLQQVTRWGRHAPH 80
gi 28806689   3 DKMMKSLAETLGIGPFIAGENGAYTIEVDQLTLTIKQHSSWILWETALPLRFNEHLDYQqEQALKRCMQLSLKTLRDTPS 82
                        90       100       110       120       130
                ....*....|....*....|....*....|....*....|....*....|....*....
1XKP_C       82 TLVLDDCGQLVLEARLRLQELDTHGLQEVINXQLALLEHLIPQLTPFSV---ASRVGWN 137
gi 1781384   81 AIVLDADGRLLLQARLGLDGLDPERLERALAAQVGLLEALAPELEPLPRglpPQAPVWR 139
gi 47606251  82 TLVLDDCGQLVLEARLRLQELDTHGLQEVINKQLALLEHLIPQLTPFSv---ASRVGWN 137
gi 27550051  81 ALTLDESENLILEARLDLDSLDAQILEQMLTMHVDLLEQVMALLSETQSspqWKQVIWQ 139
gi 28806689  83 VLTTNADQQLILQGKAMIENTSNDQFAELLAQHANVCERYMEMLEHERVnhtISHHVWL 141
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap